快速导航
学历类
职业资格
公务员
医卫类
建筑工程
外语类
外贸类
计算机类
财会类
技能鉴定
试题分类
- 全部试题
- 单选题
- 多选题
- 判断题
- 填空题
- 问答题
- 计算题
-
Selling Digital Music without Copy-protection Makes Sense
A. It was uncharacteristically low-key for the industry’s greatest showman.
But the essay published this week by Steve Jobs, the boss of Apple, on his
firm’s website under the unassuming title “Thoughts on Music” has nonetheless
provoked a vigorous debate about the future of digital music, which Apple
dominates with its iPod music-player and iTunes music-store. At issue is
“digital rights management” (DRM)—the technology guarding downloaded music
against theft. Since there is no common standard for DRM, it also has the
side-effect that songs purchased for one type of music-player may not work on
another. Apple’s DRM system, called FairPlay, is the most widespread. So it came
as a surprise when Mr. Jobs called for DRM for digital music to be
abolished.
B. This is a change of tack for Apple. It has come under fire from European
regulators who claim that its refusal to license FairPlay to other firms has
“locked in” customers. Since music from the iTunes store cannot be played on
non-iPod music-players (at least not without a lot of fiddling), any iTunes
buyer will be deterred from switching to a device made by a rival firm, such as
Sony or Microsoft. When French lawmakers drafted a bill last year compelling
Apple to open up FairPlay to rivals, the company warned of “state-sponsored
piracy”. Only DRM, it implied, could keep the pirates at bay.
C. This week Mr. Jobs gave another explanation for his former defence of DRM:
the record companies made him do it. They would make their music available to
the iTunes store only if Apple agreed to protect it using DRM. They can still
withdraw their catalogues if the DRM system is compromised. Apple cannot license
FairPlay to others, says Mr Jobs, because it would depend on them to produce
security fixes promptly. All DRM does is restrict consumer choice and provide a
barrier to entry, says Mr Jobs; without it there would be far more stores and
players, and far more innovation. So, he suggests, why not do away with DRM and
sell music unprotected? “This is clearly the best alternative for consumers,” he
declares, “and Apple would embrace it in a heartbeat.”
D. Why the sudden change of heart? Mr Jobs seems chiefly concerned with
getting Europe’s regulators off his back. Rather than complaining to Apple about
its use of DRM, he suggests, “those unhappy with the current situation should
redirect their energies towards persuading the music companies to sell their
music DRM-free.” Two and a half of the four big record companies, he helpfully
points out, are European-owned. Mr Jobs also hopes to paint himself as a
consumer champion. Apple resents accusations that it has become the Microsoft of
digital music.
E. Apple can afford to embrace open competition in music players and online
stores. Consumers would gravitate to the best player and the best store, and at
the moment that still means Apple’s. Mr Jobs is evidently unfazed by rivals to
the iPod. Since only 3% of the music in a typical iTunes library is protected,
most of it can already be used on other players today, he notes. (And even the
protected tracks can be burned onto a CD and then re-ripped.) So Apple’s
dominance evidently depends far more on branding and ease of use than
DRM-related “lock in”.
F. The music giants are trying DRM-free downloads. Lots of smaller labels
already sell music that way. Having seen which way the wind is blowing, Mr Jobs
now wants to be seen not as DRM’s defender, but as a consumer champion who
helped in its downfall. Wouldn’t it lead to a surge in piracy? No, because most
music is still sold unprotected on CDs, people wishing to steal music already
can do so. Indeed, scrapping DRM would probably increase online-music sales by
reducing confusion and incompatibility. With the leading online store, Apple
would benefit most. Mr Jobs’s argument, in short, is transparently self-serving.
It also happens to be right.
Notes to Reading Passage 1
1. low-key:
抑制的，受约束的，屈服的
2. showman:
开展览会的人, 出风头的人物
3. unassuming:
谦逊的, 不夸耀的, 不装腔作势的
4. iPod：
(苹果公司出产的)音乐播放器
5. iTunes store：
(苹果公司出产的)在线音乐商店
6. get off person’s back:
不再找某人的麻烦，摆脱某人的纠缠
7. gravitate:
受吸引，倾向于
8. unfazed:
不再担忧，不被打扰
Questions 1-7
Do the following statemets reflect the claims of the writer in Reading
Passage 1?
Write your answer in Boxes 1-7 on your answer sheet.
TRUE if the statement reflets the claims of the writer
FALSE if the statement contradicts the claims of the writer
NOT GIVEN if it is impossbile to say what the writer thinks about this
1. Apple enjoys a controlling position in digital music market with its iPod
music-player and iTunes music-store.
2. DRM is a government decree issued with a purpose to protect downloaded
music from theft by consumers.
3. Lack of standardization in DRM makes songs bought for one kind of music
player may not function on another.
4. Apple has been criticized by European regulators since it has refused to
grant a license FairPlay to other firms.
5. All music can be easily played on non-iPod music devices from Sony or
Microsoft without too much fiddling.
6. Apple depends far more on DRM rather than branding for its dominance of
the digital music devices.
7. If DRM was cancelled, Sony would certainly dominate the international
digital music market.
Questions 8-10
Choose the appropriate letters A-D and write them in boxes 8-10 on your answe
sheet.
8. Which of the following statements about Mr. Jobs’ idea of DRM is NOT
TRUE?
A. DRM places restrictions on consumer’ choice of digital music products
available.
B. DRM comples iTunes buyers to switch to a device made by Sony or
Microsoft.
C. DRM constitutes a barrier for potential consumers to enter digital music
markets.
D. DRM hinders development of more stores and players and technical
innovation.
9. The word “unfazed” in line 3 of paragraph E, means___________.
A. refused
B. welcomed
C. not bothered
D. not well received
10. Which of the following statements is TRUE if DRM was scapped?
A. Sony would gain the most profit.
B. More customers would be “locked in”.
C. A sudden increase in piracy would occur.
D. Online-music sales would probably decrease.
Questions 11-14
Complete the notes below.
Choose NO MORE THAN THREE WORDS from Reading Passage 1 for each answer.
Write your answers in boxes 11-14 on your answer sheet.
Mr. Steve Jobs, the boss of Apple, explains the reason why he used to defend
DRM, saying that the company was forced to do so: the record companies would
make their music accessible to …11...only if they agreed to protect it using
DRM; they can still…12…if the DRM system is compromised. He also provides the
reason why Apple did not license FairPlay to others: the company relies on them
to …13….But now he changes his mind with a possible expectation that Europe’s
regulators would not trouble him any more in the future. He proposes that those
who are unsatisfactory with the current situation in digital music market should
…14… towards persuade the music companies to sell their music DRM-free.
-
new weapon to fight cancer
1. British scientists are preparing to launch trials of a radical new way to
fight cancer, which kills tumours by infecting them with viruses like the common
cold.
2. If successful, virus therapy could eventually form a third pillar
alongside radiotherapy and chemotherapy in the standard arsenal against cancer,
while avoiding some of the debilitating side-effects.
3. Leonard Seymour, a professor of gene therapy at Oxford University, who has
been working on the virus therapy with colleagues in London and the US, will
lead the trials later this year. Cancer Research UK said yesterday that it was
excited by the potential of Prof Seymour’s pioneering techniques.
4. One of the country’s leading geneticists, Prof Seymour has been working
with viruses that kill cancer cells directly, while avoiding harm to healthy
tissue. "In principle, you’ve got something which could be many times more
effective than regular chemotherapy," he said.
5. Cancer-killing viruses exploit the fact that cancer cells suppress the
body’s local immune system. "If a cancer doesn’t do that, the immune system
wipes it out. If you can get a virus into a tumour, viruses find them a very
good place to be because there’s no immune system to stop them replicating. You
can regard it as the cancer’s Achilles’ heel."
6. Only a small amount of the virus needs to get to the cancer. "They
replicate, you get a million copies in each cell and the cell bursts and they
infect the tumour cells adjacent and repeat the process," said Prof Seymour.
7. Preliminary research on mice shows that the viruses work well on tumours
resistant to standard cancer drugs. "It’s an interesting possibility that they
may have an advantage in killing drug-resistant tumours, which could be quite
different to anything we’ve had before."
8. Researchers have known for some time that viruses can kill tumour cells
and some aspects of the work have already been published in scientific journals.
American scientists have previously injected viruses directly into tumours but
this technique will not work if the cancer is inaccessible or has spread
throughout the body.
9. Prof Seymour’s innovative solution is to mask the virus from the body’s
immune system, effectively allowing the viruses to do what chemotherapy drugs do
- spread through the blood and reach tumours wherever they are. The big hurdle
has always been to find a way to deliver viruses to tumours via the bloodstream
without the body’s immune system destroying them on the way.
10. "What we’ve done is make chemical modifications to the virus to put a
polymer coat around it - it’s a stealth virus when you inject it," he said.
11. After the stealth virus infects the tumour, it replicates, but the copies
do not have the chemical modifications. If they escape from the tumour, the
copies will be quickly recognised and mopped up by the body’s immune system.
12. The therapy would be especially useful for secondary cancers, called
metastases, which sometimes spread around the body after the first tumour
appears. "There’s an awful statistic of patients in the west ... with malignant
cancers; 75% of them go on to die from metastases," said Prof Seymour.
13. Two viruses are likely to be examined in the first clinical trials:
adenovirus, which normally causes a cold-like illness, and vaccinia, which
causes cowpox and is also used in the vaccine against smallpox. For safety
reasons, both will be disabled to make them less pathogenic in the trial, but
Prof Seymour said he eventually hopes to use natural viruses.
14. The first trials will use uncoated adenovirus and vaccinia and will be
delivered locally to liver tumours, in order to establish whether the treatment
is safe in humans and what dose of virus will be needed. Several more years of
trials will be needed, eventually also on the polymer-coated viruses, before the
therapy can be considered for use in the NHS. Though the approach will be
examined at first for cancers that do not respond to conventional treatments,
Prof Seymour hopes that one day it might be applied to all cancers.
Questions 1-6
Do the following statements agree with the information given in the reading
passage? For questions 1-6 write
TRUE if the statement agrees with the information
FALSE if the statement contradicts the information
NOT GIVEN if there is no information on this in the passage
1.Virus therapy, if successful, has an advantage in eliminating
side-effects.
2.Cancer Research UK is quite hopeful about Professor Seymour’s work on the
virus therapy.
3.Virus can kill cancer cells and stop them from growing again.
4.Cancer’s Achilles’ heel refers to the fact that virus may stay safely in a
tumor and replicate.
5.To infect the cancer cells, a good deal of viruses should be injected into
the tumor.
6.Researches on animals indicate that virus could be used as a new way to
treat drug-resistant tumors.
Question 7-9
Based on the reading passage, choose the appropriate letter from A-D for each
answer.
7.Information about researches on viruses killing tumor cells can be
found
(A) on TV
(B) in magazines
(C) on internet
(D) in newspapers
8.To treat tumors spreading out in body, researchers try to
(A) change the body’ immune system
(B) inject chemotherapy drugs into bloodstream.
(C) increase the amount of injection
(D) disguise the viruses on the way to tumors.
9.When the chemical modified virus in tumor replicates, the copies
(A) will soon escape from the tumor and spread out.
(B) will be wiped out by the body’s immune system.
(C) will be immediately recognized by the researchers.
(D) will eventually stop the tumor from spreading out.
Questions 10-13
Complete the sentences below. Choose your answers from the list of words. You
can only use each word once.
NB There are more words in the list than spaces so you will not use them
all.
In the first clinical trials, scientists will try to ……10…… adenovirus and
vaccinia, so both the viruses will be less pathogenic than the ……11…….These
uncoated viruses will be applied directly to certain areas to confirm safety on
human beings and the right ……12…… needed. The experiments will firstly be
……13……to the treatment of certain cancers
-
How a Frenchman is reviving McDonald’s in Europe
A. When Denis Hennequin took over as the European boss of McDonald’s in
January 2004, the world’s biggest restaurant chain was showing signs of recovery
in America and Australia, but sales in Europe were sluggish or declining. One
exception was France, where Mr Hennequin had done a sterling job as head of the
group’s French subsidiary to sell more Big Macs to his compatriots. His task was
to replicate this success in all 41 of the European countries where
anti-globalisers’ favourite enemy operates.
B. So far Mr Hennequin is doing well. Last year European sales increased by
5.8% and the number of customers by 3.4%, the best annual results in nearly 15
years. Europe accounted for 36% of the group’s profits and for 28% of its sales.
December was an especially good month as customers took to seasonal menu
offerings in France and Britain, and to a promotion in Germany based on the game
of Monopoly.
C. Mr Hennequin’s recipe for revival is to be more open about his company’s
operations, to be “locally relevant”, and to improve the experience of visiting
his 6,400 restaurants. McDonald’s is blamed for making people fat, exploiting
workers, treating animals cruelly, polluting the environment and simply for
being American. Mr Hennequin says he wants to engage in a dialogue with the
public to address these concerns.
D. He introduced “open door” visitor days in each country which became hugely
popular. In Poland alone some 50,000 visitors came to McDonald’s through the
visitors’ programme last year. The Nutrition Information Initiative, launched
last year, put detailed labels on McDonald’s packaging with data on calories,
protein, fat, carbohydrates and salt content. The details are also printed on
tray-liners.
E. Mr Hennequin also wants people to know that “McJobs”, the low-paid menial
jobs at McDonald’s restaurants, are much better than people think. But some of
his efforts have backfired: last year he sparked a controversy with the
introduction of a “McPassport” that allows McDonald’s employees to work anywhere
in the European Union. Politicians accused the firm of a ploy to make cheap
labour from eastern Europe more easily available to McDonald’s managers across
the continent.
F. To stay in touch with local needs and preferences, McDonald’s employs
local bosses as much as possible. A Russian is running McDonald’s in Russia,
though a Serb is in charge of Germany. The group buys mainly from local
suppliers. Four-fifths of its supplies in France come from local farmers, for
example. (Some of the French farmers who campaigned against the company in the
late 1990s subsequently discovered that it was, in fact, buying their produce.)
And it hires celebrities such as Heidi Klum, a German model, as local brand
ambassadors.
G. In his previous job Mr Hennequin established a “design studio” in France
to spruce up his company’s drab restaurants and adapt the interior to local
tastes. The studio is now masterminding improvements everywhere in Europe. He
also set up a “food studio”, where cooks devise new recipes in response to local
trends.
H. Given France’s reputation as the most anti-American country in Europe, it
seems odd that McDonald’s revival in Europe is being led by a Frenchman, using
ideas cooked up in the French market. But France is in fact the company’s most
profitable market after America. The market where McDonald’s is weakest in
Europe is not France, but Britain.
I. “Fixing Britain should be his priority,” says David Palmer, a restaurant
analyst at UBS. Almost two-thirds of the 1,214 McDonald’s restaurants in Britain
are company-owned, compared with 40% in Europe and 15% in America. The company
suffers from the volatility of sales at its own restaurants, but can rely on
steady income from franchisees. So it should sell as many underperforming
outlets as possible, says Mr Palmer.
J. M.Mark Wiltamuth, an analyst at Morgan Stanley, estimates that European
company-owned restaurants’ margins will increase slightly to 16.4% in 2007. This
is still less than in the late 1990s and below America’s 18-19% today. But it is
much better than before Mr Hennequin’s reign. He is already being tipped as the
first European candidate for the group’s top job in Illinois. Nobody would call
that a McJob.
Notes to Reading Passage 1
1.sterling高质量的
e.g. He has many sterling qualities. 他身上有许多优秀的品质。
2. menial 不体面的, 乏味的(工作、职业)
3. spruce up打扮整齐、漂亮、装饰
4. mastermind指挥、谋划(一个计划或活动)
e.g. The police know who masterminded the robbery.警察知道是谁策划了那次抢劫。
5. underperform表现不佳表现出低于标准的工作水平、企业出现亏本
Questions 1-6
Do the following statements reflect the claims of the writer in Reading
Passage 1?
Write your answer in Boxes 1-6 on your answer sheet.
TRUE if the statement reflects the claims of the writer
FALSE if the statement contradicts the claims of the writer
NOT GIVEN if it is impossible to say what the writer thinks about this
1. McDonald was showing the sign of recovery in all European countries except
France after Denis Hennequin took office as the boss of Euro-markets.
2. Starting from last year, detailed labels are put on McDonald’s packaging
and detailed information is also printed on tray-liners.
3. France is said to be the most anti-American country in Europe, but the
ideas of the “open door” visiting days and “McPassport” are invented in the
French market.
4. Britain possesses the weakest McDonald market among European countries and
approximately 1214 McDonald’s restaurants are company-owned.
5. According to David Palmer, a restaurant analyst at UBS, David Hennequin
should treat the problem about McDonald in Britain as the most important
thing.
6. David Palmer suggested that the management of McDonalod in Italy should
sell as many its outlets which lose money in business as possible for
revival.
Questions 7-10
Choose the appropriate letters A-D and write them in boxes 7-10 on your answe
sheet.
7. The word “sterling” in line 3 of Paragraph A means__________.
A. difficult
B. menial
C. terrible
D. excellent
8. Which of the following statements on the accusation of MacDonald is NOT
TRUE?
A. It tends to make people fat.
B. Its operations are very vague.
C. It tends to exploit workers.
D. It tends to treat animals cruelly.
9. Which of the following measures taken by Denis Hennequin produced
undesired result?
A. “Food Studio” scheme.
B. “Open Door” visitor days.
C. The “McPassport” scheme.
D. The Nutrition Information Initiative.
10. What did Denis Hennequin do so as to respond to local trends?
A. set up a “Food Studio” .
B. established a “Design Studio”.
C. hired celebrities as local brand ambassadors.
D. employed local bosses as much as possible.
Questions 11-14
Complete each of the following statements (Questions 11-14) with words or
number taken from Reading Passage 1.
Write NO MORE THAN THREE WORDS for each answer.
Write your answers in boxes 11-14 on your answer sheet.
11. After January 2004, McDonald was making improvement following a period of
slump in America and Australia, but sales in Europe were ………………………….
12. Business of McDonald in France and Britain was particularly good in
December since customers took to ……………………………..
13. Compared with other countries, France is McDonald’s ………………………. next to
America.
14. ……………………. of McDonald’s restaurants in America are companied–owned and
the figure is much lower than that in Britain.
-
1 There's a dimmer switch inside the sun that causes its brightness to rise
and fall on timescales of around 100,000 years - exactly the same period as
between ice ages on Earth. So says a physicist who has created a computer model
of our star's core.
2 Robert Ehrlich of George Mason University in Fairfax, Virginia, modelled
the effect of temperature fluctuations in the sun's interior. According to the
standard view, the temperature of the sun's core is held constant by the
opposing pressures of gravity and nuclear fusion. However, Ehrlich believed that
slight variations should be possible.
3 He took as his starting point the work of Attila Grandpierre of the Konkoly
Observatory of the Hungarian Academy of Sciences. In 2005, Grandpierre and a
collaborator, Gábor ágoston, calculated that magnetic fields in the sun's core
could produce small instabilities in the solar plasma. These instabilities would
induce localised oscillations in temperature.
4 Ehrlich's model shows that whilst most of these oscillations cancel each
other out, some reinforce one another and become long-lived temperature
variations. The favoured frequencies allow the sun's core temperature to
oscillate around its average temperature of 13.6 million kelvin in cycles
lasting either 100,000 or 41,000 years. Ehrlich says that random interactions
within the sun's magnetic field could flip the fluctuations from one cycle
length to the other.
5 These two timescales are instantly recognisable to anyone familiar with
Earth's ice ages: for the past million years, ice ages have occurred roughly
every 100,000 years. Before that, they occurred roughly every 41,000 years.
6 Most scientists believe that the ice ages are the result of subtle changes
in Earth's orbit, known as the Milankovitch cycles. One such cycle describes the
way Earth's orbit gradually changes shape from a circle to a slight ellipse and
back again roughly every 100,000 years. The theory says this alters the amount
of solar radiation that Earth receives, triggering the ice ages. However, a
persistent problem with this theory has been its inability to explain why the
ice ages changed frequency a million years ago.
7 "In Milankovitch, there is certainly no good idea why the frequency should
change from one to another," says Neil Edwards, a climatologist at the Open
University in Milton Keynes, UK. Nor is the transition problem the only one the
Milankovitch theory faces. Ehrlich and other critics claim that the temperature
variations caused by Milankovitch cycles are simply not big enough to drive ice
ages.
8 However, Edwards believes the small changes in solar heating produced by
Milankovitch cycles are then amplified by feedback mechanisms on Earth. For
example, if sea ice begins to form because of a slight cooling, carbon dioxide
that would otherwise have found its way into the atmosphere as part of the
carbon cycle is locked into the ice. That weakens the greenhouse effect and
Earth grows even colder.
9 According to Edwards, there is no lack of such mechanisms. "If you add
their effects together, there is more than enough feedback to make Milankovitch
work," he says. "The problem now is identifying which mechanisms are at work."
This is why scientists like Edwards are not yet ready to give up on the current
theory. "Milankovitch cycles give us ice ages roughly when we observe them to
happen. We can calculate where we are in the cycle and compare it with
observation," he says. "I can't see any way of testing [Ehrlich's] idea to see
where we are in the temperature oscillation."
10 Ehrlich concedes this. "If there is a way to test this theory on the sun,
I can't think of one that is practical," he says. That's because variation over
41,000 to 100,000 years is too gradual to be observed. However, there may be a
way to test it in other stars: red dwarfs. Their cores are much smaller than
that of the sun, and so Ehrlich believes that the oscillation periods could be
short enough to be observed. He has yet to calculate the precise period or the
extent of variation in brightness to be expected.
11 Nigel Weiss, a solar physicist at the University of Cambridge, is far from
convinced. He describes Ehrlich's claims as "utterly implausible". Ehrlich
counters that Weiss's opinion is based on the standard solar model, which fails
to take into account the magnetic instabilities that cause the temperature
fluctuations.
Questions 1-4
Complete each of the following statements with One or Two names of the
scientists from the box below.
Write the appropriate letters A-E in boxes 1-4 on your answer sheet.
A. Attila Grandpierre
B. Gábor ágoston
C. Neil Edwards
D. Nigel Weiss
E. Robert Ehrlich
1. ...claims there a dimmer switch inside the sun that causes its brightness
to rise and fall in periods as long as those between ice ages on Earth.
2. ...calculated that the internal solar magnetic fields could produce
instabilities in the solar plasma.
3. ...holds that Milankovitch cycles can induce changes in solar heating on
Earth and the changes are amplified on Earth.
4. ...doesn't believe in Ehrlich's viewpoints at all.
Questions 5-9
Do the following statements agree with the information given in the reading
passage?
In boxes 5-9 on your answer sheet write
TRUE if the statement is true according to the passage
FALSE if the statement is false according to the passage
NOT GIVEN if the information is not given in the passage
5. The ice ages changed frequency from 100,000 to 41,000 years a million
years ago.
6. The sole problem that the Milankovitch theory can not solve is to explain
why the ice age frequency should shift from one to another.
7. Carbon dioxide can be locked artificially into sea ice to eliminate the
greenhouse effect.
8. Some scientists are not ready to give up the Milankovitch theory though
they haven't figured out which mechanisms amplify the changes in solar
heating.
9. Both Edwards and Ehrlich believe that there is no practical way to test
when the solar temperature oscillation begins and when ends.
Questions 10-14
Complete the notes below.
Choose one suitable word from the Reading Passage above for each answer.
Write your answers in boxes 10-14 on your answer sheet.
The standard view assumes that the opposing pressures of gravity and nuclear
fusions hold the temperature ...10...in the sun's interior, but the slight
changes in the earth's ...11... alter the temperature on the earth and cause ice
ages every 100,000 years. A British scientist, however, challenges this view by
claiming that the internal solar magnetic ...12... can induce the temperature
oscillations in the sun's interior. The sun's core temperature oscillates around
its average temperature in ...13... lasting either 100,000 or 41,000 years. And
the ...14... interactions within the sun's magnetic field could flip the
fluctuations from one cycle length to the other, which explains why the ice ages
changed frequency a million years ago.
-
Felicity Lawrence
Thursday December 28, 2006
The Guardian
1. Consumers are to be presented with two rival new year advertising
campaigns as the Food Standards Agency goes public in its battle with the
industry over the labelling of unhealthy foods.
2. The Guardian has learned that the FSA will launch a series of 10-second
television adverts in January telling shoppers how to follow a red, amber and
green traffic light labelling system on the front of food packs, which is
designed to tackle Britain’s obesity epidemic.
3. The campaign is a direct response to a concerted attempt by leading food
manufacturers and retailers, including Kellogg’s and Tesco, to derail the
system. The industry fears that traffic lights would demonise entire categories
of foods and could seriously damage the market for those that are fatty, salty
or high in sugar.
4. The UK market for breakfast cereals is worth ￡1.27bn a year and the
manufacturers fear it will be severely dented if red light labels are put on
packaging drawing attention to the fact that the majority are high in salt
and/or sugar.
5. The industry is planning a major marketing campaign for a competing
labelling system which avoids colour-coding in favour of information about the
percentage of "guideline daily amounts" (GDAs) of fat, salt and sugar contained
in their products.
6. The battle for the nation’s diet comes as new rules on television
advertising come into force in January which will bar adverts for unhealthy
foods from commercial breaks during programmes aimed at children. Sources at the
TV regulators are braced for a legal challenge from the industry and have
described the lobbying efforts to block any new ad ban or colour-coded labelling
as "the most ferocious we’ve ever experienced".
7. Ofcom’s chief executive, Ed Richards, said: "We are prepared to face up to
any legal action from the industry, but we very much hope it will not be
necessary." The FSA said it was expecting an onslaught from the industry in
January. Senior FSA officials said the manufacturers’ efforts to undermine its
proposals on labelling could threaten the agency’s credibility.
8. Terrence Collis, FSA director of communications, dismissed claims that the
proposals were not based on science. "We have some of the most respected
scientists in Europe, both within the FSA and in our independent advisory
committees. It is unjustified and nonsensical to attack the FSA’s scientific
reputation and to try to undermine its credibility."
9. The FSA is understood to have briefed its ad agency, United, before
Christmas, and will aim to air ads that are "non-confrontational, humorous and
factual" as a counterweight to industry’s efforts about the same time. The
agency, however, will have a tiny fraction of the budget available to the
industry.
10. Gavin Neath, chairman of Unilever UK and president of the Food and Drink
Federation, has said that the industry has made enormous progress but could not
accept red "stop" signs on its food.
11. Alastair Sykes, chief executive of Nestlé UK, said that under the FSA
proposals all his company’s confectionery and most of its cereals would score a
red. "Are we saying people shouldn’t eat confectionery? We’re driven by
consumers and what they want, and much of what we do has been to make our
products healthier," he said.
12. Chris Wermann, director of communications at Kellogg’s, said: "In
principle we could never accept traffic light labelling."
13. The rival labelling scheme introduced by Kellogg’s, Danone, Unilever,
Nestlé, Kraft and Tesco and now favoured by 21 manufacturers, uses an
industry-devised system based on identifying GDAs of key nutrients. Tesco says
it has tested both traffic lights and GDA labels in its stores and that the
latter increased sales of healthier foods.
14. But the FSA said it could not live with this GDA system alone because it
was "not scientific" or easy for shoppers to understand at a glance.
Questions 1-6
Answer the questions below using NO MORE THAN THREE WORDS from the passage
for each answer.
1. When will instructions be given on reading the color-coded labels?
2. Where can customers find the red light labels?
3. What problem is the FSA trying to handle with the labeling system?
4. Which product sells well but may not be healthy?
5. What information, according to the manufacturers, can be labeled on
products?
6. What can not be advertised during children’s programmes?
Questions 7-13
Use the information in the text to match the people (listed A-E) with the
opinions (listed 7-13) below. Write the appropriate letter (A-E) for questions
1-7.
NB You may use any letter more than once.
A Ed Richard
B Terrence Collis
C Gavin Neath
D Alastair Sykes
E Chris Wermann
7. Generally we will not agree to use the red light labels.
8. It is unreasonable to doubt if FSA is trustworthy.
9. We are trying to meet our consumers’ needs.
10. The food industry has been improving greatly.
11. The color-coded labeling system is scientific.
12. Our products will be labeled unhealthy by the FSA.
13. We are ready to confront the manufacturers.
-
1. A European spacecraft took off today to spearhead the search for another
"Earth" among the stars.
2. The Corot space telescope blasted off aboard a Russian Soyuz rocket from
the Baikonur cosmodrome in Kazakhstan shortly after 2.20pm.
3. Corot, short for convection rotation and planetary transits, is the first
instrument capable of finding small rocky planets beyond the solar system. Any
such planet situated in the right orbit stands a good chance of having liquid
water on its surface, and quite possibly life, although a leading scientist
involved in the project said it was unlikely to find "any little green men".
4. Developed by the French space agency, CNES, and partnered by the European
Space Agency (ESA), Austria, Belgium, Germany, Brazil and Spain, Corot will
monitor around 120,000 stars with its 27cm telescope from a polar orbit 514
miles above the Earth. Over two and a half years, it will focus on five to six
different areas of the sky, measuring the brightness of about 10,000 stars every
512 seconds.
5. "At the present moment we are hoping to find out more about the nature of
planets around stars which are potential habitats. We are looking at habitable
planets, not inhabited planets. We are not going to find any little green men,"
Professor Ian Roxburgh, an ESA scientist who has been involved with Corot since
its inception, told the BBC Radio 4 Today programme.
6. Prof Roxburgh said it was hoped Corot would find "rocky planets that could
develop an atmosphere and, if they are the right distance from their parent
star, they could have water".
7. To search for planets, the telescope will look for the dimming of
starlight caused when an object passes in front of a star, known as a "transit".
Although it will take more sophisticated space telescopes planned in the next 10
years to confirm the presence of an Earth-like planet with oxygen and liquid
water, Corot will let scientists know where to point their lenses.
8. Measurements of minute changes in brightness will enable scientists to
detect giant Jupiter-like gas planets as well as small rocky ones. It is the
rocky planets - that could be no bigger than about twice the size of the Earth -
which will cause the most excitement. Scientists expect to find between 10 and
40 of these smaller planets.
9. Corot will also probe into stellar interiors by studying the acoustic
waves that ripple across the surface of stars, a technique called
"asteroseismology".
10. The nature of the ripples allows astronomers to calculate a star’s
precise mass, age and chemical composition.
11. "A planet passing in front of a star can be detected by the fall in light
from that star. Small oscillations of the star also produce changes in the light
emitted, which reveal what the star is made of and how they are structured
internally. This data will provide a major boost to our understanding of how
stars form and evolve," Prof Roxburgh said.
12. Since the discovery in 1995 of the first "exoplanet" - a planet orbiting
a star other than the Sun - more than 200 others have been found by ground-based
observatories.
13. Until now the usual method of finding exoplanets has been to detect the
"wobble" their gravity imparts on parent stars. But only giant gaseous planets
bigger than Jupiter can be found this way, and they are unlikely to harbour
life.
14. In the 2010s, ESA plans to launch Darwin, a fleet of four or five
interlinked space telescopes that will not only spot small rocky planets, but
analyse their atmospheres for signs of biological activity.
15. At around the same time, the US space agency, Nasa, will launch
Terrestrial Planet Finder, another space telescope designed to locate Earth-like
planets.
Choose the appropriate letter from A-D for question 1.
1. Corot is an instrument which
(A) can help to search for certain planets
(B) is used to find planets in the orbit
(C) can locate planets with human beings
(D) can spot any planets with water.
Do the following statements agree with the information given in the reading
passage? For questions 2-5 write
TRUE if the statement agrees with the information
FALSE if the statement contraicts the information
NOT GIVEN if there is no information on this in the passage
2. Scientists are trying to find out about the planets that can be
inhabited.
3. BBC Radio 4 recently focuses on the broadcasting of Corot.
4. Passing objects might cause a fall in light.
5. Corot can tell whether there is another Earth-like planet.
Based on your reading of the passage, complete the sentences below with words
taken from the passage. Use NO MORE THAN THREE WORDS for each answer.
With measurements, scientists will be able to search for some gaseous and
rocky planets. They will be extremely excited if they can discover some small 6.
__________, the expected number of which could be up to 7. __________ .
Corot will enable scientists to study the 8. __________ of stars. In this
way, a star’s mass, age and chemical composition can be calculated.
According to Prof Roxburgh, changes in light can be caused by passing planets
or star 9. __________. The related statistics can gain us a better 10.
__________ of the star formation and evolvement.
Observatories have found many exoplanets, which are 11. __________ other
stars than the Sun. The common way used in finding exoplanets can only detect
huge gas planets, which do not 12. ___________ .
With the launching of Darwin, astronomers will be able to analyse whether
those rocky planets have 13. __________ for life.
-
Don't wash those fossils!
Standard museum practice can wash away DNA.
1.Washing, brushing and varnishing fossils — all standard conservation
treatments used by many fossil hunters and museum curators alike — vastly
reduces the chances of recovering ancient DNA.
2.Instead, excavators should be handling at least some of their bounty with
gloves, and freezing samples as they are found, dirt and all, concludes a paper
in the Proceedings of the National Academy of Sciences today.
3.Although many palaeontologists know anecdotally that this is the best way
to up the odds of extracting good DNA, Eva-Maria Geigl of the Jacques Monod
Institute in Paris, France, and her colleagues have now shown just how important
conservation practices can be.This information, they say, needs to be hammered
home among the people who are actually out in the field digging up bones.
4.Geigl and her colleagues looked at 3,200-year-old fossil bones belonging to
a single individual of an extinct cattle species, called an aurochs.The fossils
were dug up at a site in France at two different times — either in 1947, and
stored in a museum collection, or in 2004, and conserved in sterile conditions
at -20 oC.
5.The team's attempts to extract DNA from the 1947 bones all failed.The newly
excavated fossils, however, all yielded DNA.
6.Because the bones had been buried for the same amount of time, and in the
same conditions, the conservation method had to be to blame says Geigl."As much
DNA was degraded in these 57 years as in the 3,200 years before," she says.
Wash in, wash out
7.Because many palaeontologists base their work on the shape of fossils
alone, their methods of conservation are not designed to preserve DNA, Geigl
explains.
8.The biggest problem is how they are cleaned.Fossils are often washed
together on-site in a large bath, which can allow water — and contaminants in
the form of contemporary DNA — to permeate into the porous bones."Not only is
the authentic DNA getting washed out, but contamination is getting washed in,"
says Geigl.
9.Most ancient DNA specialists know this already, says Hendrik Poinar, an
evolutionary geneticist at McMaster University in Ontario, Canada.But that
doesn't mean that best practice has become widespread among those who actually
find the fossils.
10.Getting hold of fossils that have been preserved with their DNA in mind
relies on close relationships between lab-based geneticists and the excavators,
says palaeogeneticist Svante P bo of the Max Planck Institute for Evolutionary
Anthropology in Leipzig, Germany.And that only occurs in exceptional cases, he
says.
11.P bo's team, which has been sequencing Neanderthal DNA, continually faces
these problems."When you want to study ancient human and Neanderthal remains,
there's a big issue of contamination with contemporary human DNA," he says.
12.This doesn't mean that all museum specimens are fatally flawed, notes P
bo.The Neanderthal fossils that were recently sequenced in his own lab, for
example, had been part of a museum collection treated in the traditional way.But
P bo is keen to see samples of fossils from every major find preserved in line
with Geigl's recommendations — just in case.
Warm and wet
13.Geigl herself believes that, with cooperation between bench and field
researchers, preserving fossils properly could open up avenues of discovery that
have long been assumed closed.
14.Much human cultural development took place in temperate regions.DNA does
not survive well in warm environments in the first place, and can vanish when
fossils are washed and treated.For this reason, Geigl says, most ancient DNA
studies have been done on permafrost samples, such as the woolly mammoth, or on
remains sheltered from the elements in cold caves — including cave bear and
Neanderthal fossils.
15.Better conservation methods, and a focus on fresh fossils, could boost DNA
extraction from more delicate specimens, says Geigl.And that could shed more
light on the story of human evolution.
(640 words nature )
Glossary
Palaeontologists 古生物学家
Aurochs 欧洲野牛
Neanderthal (人类学)尼安德特人，旧石器时代的古人类。
Permafrost (地理)永冻层
Questions 1-6
Answer the following questions by using NO MORE THAN THREE WORDS for each
answer.
1.How did people traditionally treat fossils?
2.What suggestions do Geigl and her colleagues give on what should be done
when fossils are found?
3.What problems may be posed if fossil bones are washed on-site? Name
ONE.
4.What characteristic do fossil bones have to make them susceptible to be
contaminated with contemporary DNA when they are washed?
5.What could be better understood when conservation treatments are
improved?
6.The passage mentioned several animal species studied by researchers.How
many of them are mentioned?
Questions 7-11
Do the following statements agree with the information given in the passage?
Please write TRUE if the statement agrees with the writer FALSE if the statement
does not agree with the writer NOT GIVEN if there is no information about this
in the passage.
7.In their paper published in the Proceedings of the National Academy of
Sciences，Geigl and her colleagues have shown what conservation practices should
be followed to preserve ancient DNA.
8.The fossil bones that Geigl and her colleagues studied are all from the
same aurochs.
9.Geneticists don't have to work on site.
10.Only newly excavated fossil bones using new conservation methods suggested
by Geigl and her colleagues contain ancient DNA.
11.Paabo is still worried about the potential problems caused by treatments
of fossils in traditional way.
Questions 12-13
Complete the following the statements by choosing letter A-D for each
answer.
12.“This information” in paragraph 3 indicates:
[A] It is critical to follow proper practices in preserving ancient DNA.
[B] The best way of getting good DNA is to handle fossils with gloves.
[C] Fossil hunters should wear home-made hammers while digging up bones.
[D] Many palaeontologists know how one should do in treating fossils.
13.The study conducted by Geigl and her colleagues suggests:
[A] the fact that ancient DNA can not be recovered from fossil bones
excavated in the past.
[B] the correlation between the amount of burying time and that of the
recovered DNA.
[C] the pace at which DNA degrades.
[D] the correlation between conservation practices and degradation of
DNA.
-
-
Rogue theory of smell gets a boost
1.A controversial theory of how we smell, which claims that our fine sense of
odour depends on quantum mechanics, has been given the thumbs up by a team of
physicists.
2.Calculations by researchers at University College London (UCL) show that
the idea that we smell odour molecules by sensing their molecular vibrations
makes sense in terms of the physics involved.
3.That's still some way from proving that the theory, proposed in the
mid-1990s by biophysicist Luca Turin, is correct.But it should make other
scientists take the idea more seriously.
4."This is a big step forward," says Turin, who has now set up his own
perfume company Flexitral in Virginia.He says that since he published his
theory, "it has been ignored rather than criticized."
5.Most scientists have assumed that our sense of smell depends on receptors
in the nose detecting the shape of incoming molecules, which triggers a signal
to the brain.This molecular 'lock and key' process is thought to lie behind a
wide range of the body's detection systems: it is how some parts of the immune
system recognise invaders, for example, and how the tongue recognizes some
tastes.
6.But Turin argued that smell doesn't seem to fit this picture very
well.Molecules that look almost identical can smell very different — such as
alcohols, which smell like spirits, and thiols, which smell like rotten eggs.And
molecules with very different structures can smell similar.Most strikingly, some
molecules can smell different — to animals, if not necessarily to humans —
simply because they contain different isotopes (atoms that are chemically
identical but have a different mass).
7.Turin's explanation for these smelly facts invokes the idea that the smell
signal in olfactory receptor proteins is triggered not by an odour molecule's
shape, but by its vibrations, which can enourage an electron to jump between two
parts of the receptor in a quantum-mechanical process called tunnelling.This
electron movement could initiate the smell signal being sent to the brain.
8.This would explain why isotopes can smell different: their vibration
frequencies are changed if the atoms are heavier.Turin's mechanism, says
Marshall Stoneham of the UCL team, is more like swipe-card identification than a
key fitting a lock.
9.Vibration-assisted electron tunnelling can undoubtedly occur — it is used
in an experimental technique for measuring molecular vibrations."The question is
whether this is possible in the nose," says Stoneham's colleague, Andrew
Horsfield.
10.Stoneham says that when he first heard about Turin's idea, while Turin was
himself based at UCL, "I didn't believe it".But, he adds, "because it was an
interesting idea, I thought I should prove it couldn't work.I did some simple
calculations, and only then began to feel Luca could be right." Now Stoneham and
his co-workers have done the job more thoroughly, in a paper soon to be
published in Physical Review Letters.
11.The UCL team calculated the rates of electron hopping in a nose receptor
that has an odorant molecule bound to it.This rate depends on various properties
of the biomolecular system that are not known, but the researchers could
estimate these parameters based on typical values for molecules of this
sort.
12.The key issue is whether the hopping rate with the odorant in place is
significantly greater than that without it.The calculations show that it is —
which means that odour identification in this way seems theoretically
possible.
13.But Horsfield stresses that that's different from a proof of Turin's
idea."So far things look plausible, but we need proper experimental
verification.We're beginning to think about what experiments could be
performed."
14.Meanwhile, Turin is pressing ahead with his hypothesis."At Flexitral we
have been designing odorants exclusively on the basis of their computed
vibrations," he says."Our success rate at odorant discovery is two orders of
magnitude better than the competition." At the very least, he is putting his
money where his nose is.
Questions 5-9
Complete the sentences below with words from the passage.Use NO MORE THAN
THREE WORDS for each answer.
5.The hypothesis that we smell by sensing the molecular vibration was made by
______.
6.Turin's company is based in ______.
7.Most scientists believed that our nose works in the same way as our
______.
8.Different isotopes can smell different when ______ weigh differently.
9.According to Audrew Horsfield, it is still to be proved that ______ could
really occur in human nose.
-
-
In the earliest stages of man's development he had nomore need of money than animals have.He was content with very simple forms of shelter,made his own rough tools and weapons and could provide food and clothing for himself and his family from natural materials around him.As he became more civilized,however,he began to want better shelter,more efficient tools and weapons,and more comfortable and more lasting clothing than could be provided by his own neighborhood or by the work of his own unskilled hands.For these things he had to turn to the skilled people such as smiths,leather workers or carpenters.It was then that the question of payment arose.
At first he got what he wanted by a simple process ofexchange.The smith who had not the time to look after land or cattle was glad to take meat or grain from the farmer inexchange for an axe or a plough.But as more and more goods which had no fixed exchange value came on the market,exchange became too complicated to be satisfactory.Another problem arose when those who made things wanted to get stocks of wood or leather,or iron,but had nothing to offer in exchange until their finished goods were ready. Thus the difficulties of exchange led by degrees to the invention of money.In some countries easily handled things like seeds or shells were given a certain value and the farmer,instead of paying the smith for a new axe by giving him some meat or grain,gave him so many shells.If the smith had any shells left when he had bought his food,he could get stocks of the raw materials of his trade.In some countries quite large things such as cows or camels or even big flat stones were used for trade.Later,pieces of metal,bearing values according to the rarity of the metal and the size of the pieces,or coins were used.Money as we know it had arrived.
1.Exchange of goods became difficult because _________.
A man became more civilized
B smiths began to look after land or cattle in their spare time
C more and more goods which had no fixed exchange alues came to the
marker
D farmers hadn't enough grain or meat to provide for
skilled workers
2.Money was not used until _______.
A paper was invented
B people practiced a simple process of exchange
C nothing could be offered in exchangeD the exchange of one thing for another became too complicated
3.The best title for this passage is _____.
A What is money
B What are money's functions.
C The importance of money
D The beginning of money
-
To begin with,"muzak"(音乐广播网 )was intended simplyto createasoothing(安慰)atmosphere.Recently,however,it's ecome big business —thanks in part to recentresearch.Dr.Ronald Milliman,an American marketing expert,hasshown that music can boost sales or increase factory roduction by as much as a third.But,it has to be light music.A fast one has no effect atall on sales.Slow music can increase receipts by 38%.This isprobably because shoppers slow down and have more opportunityto spot items they like to buy.Yet,slow music isn't alway sanswer.Dr.Milliman found,for example,that in restaurants slowmusic meant customers took longer to eat their meals,whichreduced overall sales.So restaurants owners might be welladvised to play up-tempo music to keep the customers moving—unless of course,the resulting indigestion leads tocomplaints!
练习：
1.The reason why background music is so popular isthat ______.
A.it can have a powerful effect on those who hear it
B.it can help to create a soothing atmosphere
C.it can boost sales or increase factory production erywhere
D.it can make customers eat their meals quickly
2.Background music means ________.
A.light music that customers enjoy mostB.fast music that makes people move
fast
C.slow music that can make customers enjoy their meals
D.the music you are listening to while you are doingomething
3.Restaurant owners complain about background musicbecause ______.
A.it results in indigestion
B.it increases their sales
C.it keeps customers moving
D.it decreases their sales
4.The word"up-tempo music"probably means_____.
A.slow music
B.fast music
C.light music
D.classical music
-
-
-
-
-
-
-
-
-
Selling Digital Music without Copy-protection Makes Sense
A. It was uncharacteristically low-key for the industry’s greatest showman.
But the essay published this week by Steve Jobs, the boss of Apple, on his
firm’s website under the unassuming title “Thoughts on Music” has nonetheless
provoked a vigorous debate about the future of digital music, which Apple
dominates with its iPod music-player and iTunes music-store. At issue is
“digital rights management” (DRM)—the technology guarding downloaded music
against theft. Since there is no common standard for DRM, it also has the
side-effect that songs purchased for one type of music-player may not work on
another. Apple’s DRM system, called FairPlay, is the most widespread. So it came
as a surprise when Mr. Jobs called for DRM for digital music to be
abolished.
B. This is a change of tack for Apple. It has come under fire from European
regulators who claim that its refusal to license FairPlay to other firms has
“locked in” customers. Since music from the iTunes store cannot be played on
non-iPod music-players (at least not without a lot of fiddling), any iTunes
buyer will be deterred from switching to a device made by a rival firm, such as
Sony or Microsoft. When French lawmakers drafted a bill last year compelling
Apple to open up FairPlay to rivals, the company warned of “state-sponsored
piracy”. Only DRM, it implied, could keep the pirates at bay.
C. This week Mr. Jobs gave another explanation for his former defence of DRM:
the record companies made him do it. They would make their music available to
the iTunes store only if Apple agreed to protect it using DRM. They can still
withdraw their catalogues if the DRM system is compromised. Apple cannot license
FairPlay to others, says Mr Jobs, because it would depend on them to produce
security fixes promptly. All DRM does is restrict consumer choice and provide a
barrier to entry, says Mr Jobs; without it there would be far more stores and
players, and far more innovation. So, he suggests, why not do away with DRM and
sell music unprotected? “This is clearly the best alternative for consumers,” he
declares, “and Apple would embrace it in a heartbeat.”
D. Why the sudden change of heart? Mr Jobs seems chiefly concerned with
getting Europe’s regulators off his back. Rather than complaining to Apple about
its use of DRM, he suggests, “those unhappy with the current situation should
redirect their energies towards persuading the music companies to sell their
music DRM-free.” Two and a half of the four big record companies, he helpfully
points out, are European-owned. Mr Jobs also hopes to paint himself as a
consumer champion. Apple resents accusations that it has become the Microsoft of
digital music.
E. Apple can afford to embrace open competition in music players and online
stores. Consumers would gravitate to the best player and the best store, and at
the moment that still means Apple’s. Mr Jobs is evidently unfazed by rivals to
the iPod. Since only 3% of the music in a typical iTunes library is protected,
most of it can already be used on other players today, he notes. (And even the
protected tracks can be burned onto a CD and then re-ripped.) So Apple’s
dominance evidently depends far more on branding and ease of use than
DRM-related “lock in”.
F. The music giants are trying DRM-free downloads. Lots of smaller labels
already sell music that way. Having seen which way the wind is blowing, Mr Jobs
now wants to be seen not as DRM’s defender, but as a consumer champion who
helped in its downfall. Wouldn’t it lead to a surge in piracy? No, because most
music is still sold unprotected on CDs, people wishing to steal music already
can do so. Indeed, scrapping DRM would probably increase online-music sales by
reducing confusion and incompatibility. With the leading online store, Apple
would benefit most. Mr Jobs’s argument, in short, is transparently self-serving.
It also happens to be right.
Notes to Reading Passage 1
1. low-key:
抑制的，受约束的，屈服的
2. showman:
开展览会的人, 出风头的人物
3. unassuming:
谦逊的, 不夸耀的, 不装腔作势的
4. iPod：
(苹果公司出产的)音乐播放器
5. iTunes store：
(苹果公司出产的)在线音乐商店
6. get off person’s back:
不再找某人的麻烦，摆脱某人的纠缠
7. gravitate:
受吸引，倾向于
8. unfazed:
不再担忧，不被打扰
Questions 1-7
Do the following statemets reflect the claims of the writer in Reading
Passage 1?
Write your answer in Boxes 1-7 on your answer sheet.
TRUE if the statement reflets the claims of the writer
FALSE if the statement contradicts the claims of the writer
NOT GIVEN if it is impossbile to say what the writer thinks about this
1. Apple enjoys a controlling position in digital music market with its iPod
music-player and iTunes music-store.
2. DRM is a government decree issued with a purpose to protect downloaded
music from theft by consumers.
3. Lack of standardization in DRM makes songs bought for one kind of music
player may not function on another.
4. Apple has been criticized by European regulators since it has refused to
grant a license FairPlay to other firms.
5. All music can be easily played on non-iPod music devices from Sony or
Microsoft without too much fiddling.
6. Apple depends far more on DRM rather than branding for its dominance of
the digital music devices.
7. If DRM was cancelled, Sony would certainly dominate the international
digital music market.
Questions 8-10
Choose the appropriate letters A-D and write them in boxes 8-10 on your answe
sheet.
8. Which of the following statements about Mr. Jobs’ idea of DRM is NOT
TRUE?
A. DRM places restrictions on consumer’ choice of digital music products
available.
B. DRM comples iTunes buyers to switch to a device made by Sony or
Microsoft.
C. DRM constitutes a barrier for potential consumers to enter digital music
markets.
D. DRM hinders development of more stores and players and technical
innovation.
9. The word “unfazed” in line 3 of paragraph E, means___________.
A. refused
B. welcomed
C. not bothered
D. not well received
10. Which of the following statements is TRUE if DRM was scapped?
A. Sony would gain the most profit.
B. More customers would be “locked in”.
C. A sudden increase in piracy would occur.
D. Online-music sales would probably decrease.
Questions 11-14
Complete the notes below.
Choose NO MORE THAN THREE WORDS from Reading Passage 1 for each answer.
Write your answers in boxes 11-14 on your answer sheet.
Mr. Steve Jobs, the boss of Apple, explains the reason why he used to defend
DRM, saying that the company was forced to do so: the record companies would
make their music accessible to …11...only if they agreed to protect it using
DRM; they can still…12…if the DRM system is compromised. He also provides the
reason why Apple did not license FairPlay to others: the company relies on them
to …13….But now he changes his mind with a possible expectation that Europe’s
regulators would not trouble him any more in the future. He proposes that those
who are unsatisfactory with the current situation in digital music market should
…14… towards persuade the music companies to sell their music DRM-free.
-
new weapon to fight cancer
1. British scientists are preparing to launch trials of a radical new way to
fight cancer, which kills tumours by infecting them with viruses like the common
cold.
2. If successful, virus therapy could eventually form a third pillar
alongside radiotherapy and chemotherapy in the standard arsenal against cancer,
while avoiding some of the debilitating side-effects.
3. Leonard Seymour, a professor of gene therapy at Oxford University, who has
been working on the virus therapy with colleagues in London and the US, will
lead the trials later this year. Cancer Research UK said yesterday that it was
excited by the potential of Prof Seymour’s pioneering techniques.
4. One of the country’s leading geneticists, Prof Seymour has been working
with viruses that kill cancer cells directly, while avoiding harm to healthy
tissue. "In principle, you’ve got something which could be many times more
effective than regular chemotherapy," he said.
5. Cancer-killing viruses exploit the fact that cancer cells suppress the
body’s local immune system. "If a cancer doesn’t do that, the immune system
wipes it out. If you can get a virus into a tumour, viruses find them a very
good place to be because there’s no immune system to stop them replicating. You
can regard it as the cancer’s Achilles’ heel."
6. Only a small amount of the virus needs to get to the cancer. "They
replicate, you get a million copies in each cell and the cell bursts and they
infect the tumour cells adjacent and repeat the process," said Prof Seymour.
7. Preliminary research on mice shows that the viruses work well on tumours
resistant to standard cancer drugs. "It’s an interesting possibility that they
may have an advantage in killing drug-resistant tumours, which could be quite
different to anything we’ve had before."
8. Researchers have known for some time that viruses can kill tumour cells
and some aspects of the work have already been published in scientific journals.
American scientists have previously injected viruses directly into tumours but
this technique will not work if the cancer is inaccessible or has spread
throughout the body.
9. Prof Seymour’s innovative solution is to mask the virus from the body’s
immune system, effectively allowing the viruses to do what chemotherapy drugs do
- spread through the blood and reach tumours wherever they are. The big hurdle
has always been to find a way to deliver viruses to tumours via the bloodstream
without the body’s immune system destroying them on the way.
10. "What we’ve done is make chemical modifications to the virus to put a
polymer coat around it - it’s a stealth virus when you inject it," he said.
11. After the stealth virus infects the tumour, it replicates, but the copies
do not have the chemical modifications. If they escape from the tumour, the
copies will be quickly recognised and mopped up by the body’s immune system.
12. The therapy would be especially useful for secondary cancers, called
metastases, which sometimes spread around the body after the first tumour
appears. "There’s an awful statistic of patients in the west ... with malignant
cancers; 75% of them go on to die from metastases," said Prof Seymour.
13. Two viruses are likely to be examined in the first clinical trials:
adenovirus, which normally causes a cold-like illness, and vaccinia, which
causes cowpox and is also used in the vaccine against smallpox. For safety
reasons, both will be disabled to make them less pathogenic in the trial, but
Prof Seymour said he eventually hopes to use natural viruses.
14. The first trials will use uncoated adenovirus and vaccinia and will be
delivered locally to liver tumours, in order to establish whether the treatment
is safe in humans and what dose of virus will be needed. Several more years of
trials will be needed, eventually also on the polymer-coated viruses, before the
therapy can be considered for use in the NHS. Though the approach will be
examined at first for cancers that do not respond to conventional treatments,
Prof Seymour hopes that one day it might be applied to all cancers.
Questions 1-6
Do the following statements agree with the information given in the reading
passage? For questions 1-6 write
TRUE if the statement agrees with the information
FALSE if the statement contradicts the information
NOT GIVEN if there is no information on this in the passage
1.Virus therapy, if successful, has an advantage in eliminating
side-effects.
2.Cancer Research UK is quite hopeful about Professor Seymour’s work on the
virus therapy.
3.Virus can kill cancer cells and stop them from growing again.
4.Cancer’s Achilles’ heel refers to the fact that virus may stay safely in a
tumor and replicate.
5.To infect the cancer cells, a good deal of viruses should be injected into
the tumor.
6.Researches on animals indicate that virus could be used as a new way to
treat drug-resistant tumors.
Question 7-9
Based on the reading passage, choose the appropriate letter from A-D for each
answer.
7.Information about researches on viruses killing tumor cells can be
found
(A) on TV
(B) in magazines
(C) on internet
(D) in newspapers
8.To treat tumors spreading out in body, researchers try to
(A) change the body’ immune system
(B) inject chemotherapy drugs into bloodstream.
(C) increase the amount of injection
(D) disguise the viruses on the way to tumors.
9.When the chemical modified virus in tumor replicates, the copies
(A) will soon escape from the tumor and spread out.
(B) will be wiped out by the body’s immune system.
(C) will be immediately recognized by the researchers.
(D) will eventually stop the tumor from spreading out.
Questions 10-13
Complete the sentences below. Choose your answers from the list of words. You
can only use each word once.
NB There are more words in the list than spaces so you will not use them
all.
In the first clinical trials, scientists will try to ……10…… adenovirus and
vaccinia, so both the viruses will be less pathogenic than the ……11…….These
uncoated viruses will be applied directly to certain areas to confirm safety on
human beings and the right ……12…… needed. The experiments will firstly be
……13……to the treatment of certain cancers
-
How a Frenchman is reviving McDonald’s in Europe
A. When Denis Hennequin took over as the European boss of McDonald’s in
January 2004, the world’s biggest restaurant chain was showing signs of recovery
in America and Australia, but sales in Europe were sluggish or declining. One
exception was France, where Mr Hennequin had done a sterling job as head of the
group’s French subsidiary to sell more Big Macs to his compatriots. His task was
to replicate this success in all 41 of the European countries where
anti-globalisers’ favourite enemy operates.
B. So far Mr Hennequin is doing well. Last year European sales increased by
5.8% and the number of customers by 3.4%, the best annual results in nearly 15
years. Europe accounted for 36% of the group’s profits and for 28% of its sales.
December was an especially good month as customers took to seasonal menu
offerings in France and Britain, and to a promotion in Germany based on the game
of Monopoly.
C. Mr Hennequin’s recipe for revival is to be more open about his company’s
operations, to be “locally relevant”, and to improve the experience of visiting
his 6,400 restaurants. McDonald’s is blamed for making people fat, exploiting
workers, treating animals cruelly, polluting the environment and simply for
being American. Mr Hennequin says he wants to engage in a dialogue with the
public to address these concerns.
D. He introduced “open door” visitor days in each country which became hugely
popular. In Poland alone some 50,000 visitors came to McDonald’s through the
visitors’ programme last year. The Nutrition Information Initiative, launched
last year, put detailed labels on McDonald’s packaging with data on calories,
protein, fat, carbohydrates and salt content. The details are also printed on
tray-liners.
E. Mr Hennequin also wants people to know that “McJobs”, the low-paid menial
jobs at McDonald’s restaurants, are much better than people think. But some of
his efforts have backfired: last year he sparked a controversy with the
introduction of a “McPassport” that allows McDonald’s employees to work anywhere
in the European Union. Politicians accused the firm of a ploy to make cheap
labour from eastern Europe more easily available to McDonald’s managers across
the continent.
F. To stay in touch with local needs and preferences, McDonald’s employs
local bosses as much as possible. A Russian is running McDonald’s in Russia,
though a Serb is in charge of Germany. The group buys mainly from local
suppliers. Four-fifths of its supplies in France come from local farmers, for
example. (Some of the French farmers who campaigned against the company in the
late 1990s subsequently discovered that it was, in fact, buying their produce.)
And it hires celebrities such as Heidi Klum, a German model, as local brand
ambassadors.
G. In his previous job Mr Hennequin established a “design studio” in France
to spruce up his company’s drab restaurants and adapt the interior to local
tastes. The studio is now masterminding improvements everywhere in Europe. He
also set up a “food studio”, where cooks devise new recipes in response to local
trends.
H. Given France’s reputation as the most anti-American country in Europe, it
seems odd that McDonald’s revival in Europe is being led by a Frenchman, using
ideas cooked up in the French market. But France is in fact the company’s most
profitable market after America. The market where McDonald’s is weakest in
Europe is not France, but Britain.
I. “Fixing Britain should be his priority,” says David Palmer, a restaurant
analyst at UBS. Almost two-thirds of the 1,214 McDonald’s restaurants in Britain
are company-owned, compared with 40% in Europe and 15% in America. The company
suffers from the volatility of sales at its own restaurants, but can rely on
steady income from franchisees. So it should sell as many underperforming
outlets as possible, says Mr Palmer.
J. M.Mark Wiltamuth, an analyst at Morgan Stanley, estimates that European
company-owned restaurants’ margins will increase slightly to 16.4% in 2007. This
is still less than in the late 1990s and below America’s 18-19% today. But it is
much better than before Mr Hennequin’s reign. He is already being tipped as the
first European candidate for the group’s top job in Illinois. Nobody would call
that a McJob.
Notes to Reading Passage 1
1.sterling高质量的
e.g. He has many sterling qualities. 他身上有许多优秀的品质。
2. menial 不体面的, 乏味的(工作、职业)
3. spruce up打扮整齐、漂亮、装饰
4. mastermind指挥、谋划(一个计划或活动)
e.g. The police know who masterminded the robbery.警察知道是谁策划了那次抢劫。
5. underperform表现不佳表现出低于标准的工作水平、企业出现亏本
Questions 1-6
Do the following statements reflect the claims of the writer in Reading
Passage 1?
Write your answer in Boxes 1-6 on your answer sheet.
TRUE if the statement reflects the claims of the writer
FALSE if the statement contradicts the claims of the writer
NOT GIVEN if it is impossible to say what the writer thinks about this
1. McDonald was showing the sign of recovery in all European countries except
France after Denis Hennequin took office as the boss of Euro-markets.
2. Starting from last year, detailed labels are put on McDonald’s packaging
and detailed information is also printed on tray-liners.
3. France is said to be the most anti-American country in Europe, but the
ideas of the “open door” visiting days and “McPassport” are invented in the
French market.
4. Britain possesses the weakest McDonald market among European countries and
approximately 1214 McDonald’s restaurants are company-owned.
5. According to David Palmer, a restaurant analyst at UBS, David Hennequin
should treat the problem about McDonald in Britain as the most important
thing.
6. David Palmer suggested that the management of McDonalod in Italy should
sell as many its outlets which lose money in business as possible for
revival.
Questions 7-10
Choose the appropriate letters A-D and write them in boxes 7-10 on your answe
sheet.
7. The word “sterling” in line 3 of Paragraph A means__________.
A. difficult
B. menial
C. terrible
D. excellent
8. Which of the following statements on the accusation of MacDonald is NOT
TRUE?
A. It tends to make people fat.
B. Its operations are very vague.
C. It tends to exploit workers.
D. It tends to treat animals cruelly.
9. Which of the following measures taken by Denis Hennequin produced
undesired result?
A. “Food Studio” scheme.
B. “Open Door” visitor days.
C. The “McPassport” scheme.
D. The Nutrition Information Initiative.
10. What did Denis Hennequin do so as to respond to local trends?
A. set up a “Food Studio” .
B. established a “Design Studio”.
C. hired celebrities as local brand ambassadors.
D. employed local bosses as much as possible.
Questions 11-14
Complete each of the following statements (Questions 11-14) with words or
number taken from Reading Passage 1.
Write NO MORE THAN THREE WORDS for each answer.
Write your answers in boxes 11-14 on your answer sheet.
11. After January 2004, McDonald was making improvement following a period of
slump in America and Australia, but sales in Europe were ………………………….
12. Business of McDonald in France and Britain was particularly good in
December since customers took to ……………………………..
13. Compared with other countries, France is McDonald’s ………………………. next to
America.
14. ……………………. of McDonald’s restaurants in America are companied–owned and
the figure is much lower than that in Britain.
-
1 There's a dimmer switch inside the sun that causes its brightness to rise
and fall on timescales of around 100,000 years - exactly the same period as
between ice ages on Earth. So says a physicist who has created a computer model
of our star's core.
2 Robert Ehrlich of George Mason University in Fairfax, Virginia, modelled
the effect of temperature fluctuations in the sun's interior. According to the
standard view, the temperature of the sun's core is held constant by the
opposing pressures of gravity and nuclear fusion. However, Ehrlich believed that
slight variations should be possible.
3 He took as his starting point the work of Attila Grandpierre of the Konkoly
Observatory of the Hungarian Academy of Sciences. In 2005, Grandpierre and a
collaborator, Gábor ágoston, calculated that magnetic fields in the sun's core
could produce small instabilities in the solar plasma. These instabilities would
induce localised oscillations in temperature.
4 Ehrlich's model shows that whilst most of these oscillations cancel each
other out, some reinforce one another and become long-lived temperature
variations. The favoured frequencies allow the sun's core temperature to
oscillate around its average temperature of 13.6 million kelvin in cycles
lasting either 100,000 or 41,000 years. Ehrlich says that random interactions
within the sun's magnetic field could flip the fluctuations from one cycle
length to the other.
5 These two timescales are instantly recognisable to anyone familiar with
Earth's ice ages: for the past million years, ice ages have occurred roughly
every 100,000 years. Before that, they occurred roughly every 41,000 years.
6 Most scientists believe that the ice ages are the result of subtle changes
in Earth's orbit, known as the Milankovitch cycles. One such cycle describes the
way Earth's orbit gradually changes shape from a circle to a slight ellipse and
back again roughly every 100,000 years. The theory says this alters the amount
of solar radiation that Earth receives, triggering the ice ages. However, a
persistent problem with this theory has been its inability to explain why the
ice ages changed frequency a million years ago.
7 "In Milankovitch, there is certainly no good idea why the frequency should
change from one to another," says Neil Edwards, a climatologist at the Open
University in Milton Keynes, UK. Nor is the transition problem the only one the
Milankovitch theory faces. Ehrlich and other critics claim that the temperature
variations caused by Milankovitch cycles are simply not big enough to drive ice
ages.
8 However, Edwards believes the small changes in solar heating produced by
Milankovitch cycles are then amplified by feedback mechanisms on Earth. For
example, if sea ice begins to form because of a slight cooling, carbon dioxide
that would otherwise have found its way into the atmosphere as part of the
carbon cycle is locked into the ice. That weakens the greenhouse effect and
Earth grows even colder.
9 According to Edwards, there is no lack of such mechanisms. "If you add
their effects together, there is more than enough feedback to make Milankovitch
work," he says. "The problem now is identifying which mechanisms are at work."
This is why scientists like Edwards are not yet ready to give up on the current
theory. "Milankovitch cycles give us ice ages roughly when we observe them to
happen. We can calculate where we are in the cycle and compare it with
observation," he says. "I can't see any way of testing [Ehrlich's] idea to see
where we are in the temperature oscillation."
10 Ehrlich concedes this. "If there is a way to test this theory on the sun,
I can't think of one that is practical," he says. That's because variation over
41,000 to 100,000 years is too gradual to be observed. However, there may be a
way to test it in other stars: red dwarfs. Their cores are much smaller than
that of the sun, and so Ehrlich believes that the oscillation periods could be
short enough to be observed. He has yet to calculate the precise period or the
extent of variation in brightness to be expected.
11 Nigel Weiss, a solar physicist at the University of Cambridge, is far from
convinced. He describes Ehrlich's claims as "utterly implausible". Ehrlich
counters that Weiss's opinion is based on the standard solar model, which fails
to take into account the magnetic instabilities that cause the temperature
fluctuations.
Questions 1-4
Complete each of the following statements with One or Two names of the
scientists from the box below.
Write the appropriate letters A-E in boxes 1-4 on your answer sheet.
A. Attila Grandpierre
B. Gábor ágoston
C. Neil Edwards
D. Nigel Weiss
E. Robert Ehrlich
1. ...claims there a dimmer switch inside the sun that causes its brightness
to rise and fall in periods as long as those between ice ages on Earth.
2. ...calculated that the internal solar magnetic fields could produce
instabilities in the solar plasma.
3. ...holds that Milankovitch cycles can induce changes in solar heating on
Earth and the changes are amplified on Earth.
4. ...doesn't believe in Ehrlich's viewpoints at all.
Questions 5-9
Do the following statements agree with the information given in the reading
passage?
In boxes 5-9 on your answer sheet write
TRUE if the statement is true according to the passage
FALSE if the statement is false according to the passage
NOT GIVEN if the information is not given in the passage
5. The ice ages changed frequency from 100,000 to 41,000 years a million
years ago.
6. The sole problem that the Milankovitch theory can not solve is to explain
why the ice age frequency should shift from one to another.
7. Carbon dioxide can be locked artificially into sea ice to eliminate the
greenhouse effect.
8. Some scientists are not ready to give up the Milankovitch theory though
they haven't figured out which mechanisms amplify the changes in solar
heating.
9. Both Edwards and Ehrlich believe that there is no practical way to test
when the solar temperature oscillation begins and when ends.
Questions 10-14
Complete the notes below.
Choose one suitable word from the Reading Passage above for each answer.
Write your answers in boxes 10-14 on your answer sheet.
The standard view assumes that the opposing pressures of gravity and nuclear
fusions hold the temperature ...10...in the sun's interior, but the slight
changes in the earth's ...11... alter the temperature on the earth and cause ice
ages every 100,000 years. A British scientist, however, challenges this view by
claiming that the internal solar magnetic ...12... can induce the temperature
oscillations in the sun's interior. The sun's core temperature oscillates around
its average temperature in ...13... lasting either 100,000 or 41,000 years. And
the ...14... interactions within the sun's magnetic field could flip the
fluctuations from one cycle length to the other, which explains why the ice ages
changed frequency a million years ago.
-
Felicity Lawrence
Thursday December 28, 2006
The Guardian
1. Consumers are to be presented with two rival new year advertising
campaigns as the Food Standards Agency goes public in its battle with the
industry over the labelling of unhealthy foods.
2. The Guardian has learned that the FSA will launch a series of 10-second
television adverts in January telling shoppers how to follow a red, amber and
green traffic light labelling system on the front of food packs, which is
designed to tackle Britain’s obesity epidemic.
3. The campaign is a direct response to a concerted attempt by leading food
manufacturers and retailers, including Kellogg’s and Tesco, to derail the
system. The industry fears that traffic lights would demonise entire categories
of foods and could seriously damage the market for those that are fatty, salty
or high in sugar.
4. The UK market for breakfast cereals is worth ￡1.27bn a year and the
manufacturers fear it will be severely dented if red light labels are put on
packaging drawing attention to the fact that the majority are high in salt
and/or sugar.
5. The industry is planning a major marketing campaign for a competing
labelling system which avoids colour-coding in favour of information about the
percentage of "guideline daily amounts" (GDAs) of fat, salt and sugar contained
in their products.
6. The battle for the nation’s diet comes as new rules on television
advertising come into force in January which will bar adverts for unhealthy
foods from commercial breaks during programmes aimed at children. Sources at the
TV regulators are braced for a legal challenge from the industry and have
described the lobbying efforts to block any new ad ban or colour-coded labelling
as "the most ferocious we’ve ever experienced".
7. Ofcom’s chief executive, Ed Richards, said: "We are prepared to face up to
any legal action from the industry, but we very much hope it will not be
necessary." The FSA said it was expecting an onslaught from the industry in
January. Senior FSA officials said the manufacturers’ efforts to undermine its
proposals on labelling could threaten the agency’s credibility.
8. Terrence Collis, FSA director of communications, dismissed claims that the
proposals were not based on science. "We have some of the most respected
scientists in Europe, both within the FSA and in our independent advisory
committees. It is unjustified and nonsensical to attack the FSA’s scientific
reputation and to try to undermine its credibility."
9. The FSA is understood to have briefed its ad agency, United, before
Christmas, and will aim to air ads that are "non-confrontational, humorous and
factual" as a counterweight to industry’s efforts about the same time. The
agency, however, will have a tiny fraction of the budget available to the
industry.
10. Gavin Neath, chairman of Unilever UK and president of the Food and Drink
Federation, has said that the industry has made enormous progress but could not
accept red "stop" signs on its food.
11. Alastair Sykes, chief executive of Nestlé UK, said that under the FSA
proposals all his company’s confectionery and most of its cereals would score a
red. "Are we saying people shouldn’t eat confectionery? We’re driven by
consumers and what they want, and much of what we do has been to make our
products healthier," he said.
12. Chris Wermann, director of communications at Kellogg’s, said: "In
principle we could never accept traffic light labelling."
13. The rival labelling scheme introduced by Kellogg’s, Danone, Unilever,
Nestlé, Kraft and Tesco and now favoured by 21 manufacturers, uses an
industry-devised system based on identifying GDAs of key nutrients. Tesco says
it has tested both traffic lights and GDA labels in its stores and that the
latter increased sales of healthier foods.
14. But the FSA said it could not live with this GDA system alone because it
was "not scientific" or easy for shoppers to understand at a glance.
Questions 1-6
Answer the questions below using NO MORE THAN THREE WORDS from the passage
for each answer.
1. When will instructions be given on reading the color-coded labels?
2. Where can customers find the red light labels?
3. What problem is the FSA trying to handle with the labeling system?
4. Which product sells well but may not be healthy?
5. What information, according to the manufacturers, can be labeled on
products?
6. What can not be advertised during children’s programmes?
Questions 7-13
Use the information in the text to match the people (listed A-E) with the
opinions (listed 7-13) below. Write the appropriate letter (A-E) for questions
1-7.
NB You may use any letter more than once.
A Ed Richard
B Terrence Collis
C Gavin Neath
D Alastair Sykes
E Chris Wermann
7. Generally we will not agree to use the red light labels.
8. It is unreasonable to doubt if FSA is trustworthy.
9. We are trying to meet our consumers’ needs.
10. The food industry has been improving greatly.
11. The color-coded labeling system is scientific.
12. Our products will be labeled unhealthy by the FSA.
13. We are ready to confront the manufacturers.
-
1. A European spacecraft took off today to spearhead the search for another
"Earth" among the stars.
2. The Corot space telescope blasted off aboard a Russian Soyuz rocket from
the Baikonur cosmodrome in Kazakhstan shortly after 2.20pm.
3. Corot, short for convection rotation and planetary transits, is the first
instrument capable of finding small rocky planets beyond the solar system. Any
such planet situated in the right orbit stands a good chance of having liquid
water on its surface, and quite possibly life, although a leading scientist
involved in the project said it was unlikely to find "any little green men".
4. Developed by the French space agency, CNES, and partnered by the European
Space Agency (ESA), Austria, Belgium, Germany, Brazil and Spain, Corot will
monitor around 120,000 stars with its 27cm telescope from a polar orbit 514
miles above the Earth. Over two and a half years, it will focus on five to six
different areas of the sky, measuring the brightness of about 10,000 stars every
512 seconds.
5. "At the present moment we are hoping to find out more about the nature of
planets around stars which are potential habitats. We are looking at habitable
planets, not inhabited planets. We are not going to find any little green men,"
Professor Ian Roxburgh, an ESA scientist who has been involved with Corot since
its inception, told the BBC Radio 4 Today programme.
6. Prof Roxburgh said it was hoped Corot would find "rocky planets that could
develop an atmosphere and, if they are the right distance from their parent
star, they could have water".
7. To search for planets, the telescope will look for the dimming of
starlight caused when an object passes in front of a star, known as a "transit".
Although it will take more sophisticated space telescopes planned in the next 10
years to confirm the presence of an Earth-like planet with oxygen and liquid
water, Corot will let scientists know where to point their lenses.
8. Measurements of minute changes in brightness will enable scientists to
detect giant Jupiter-like gas planets as well as small rocky ones. It is the
rocky planets - that could be no bigger than about twice the size of the Earth -
which will cause the most excitement. Scientists expect to find between 10 and
40 of these smaller planets.
9. Corot will also probe into stellar interiors by studying the acoustic
waves that ripple across the surface of stars, a technique called
"asteroseismology".
10. The nature of the ripples allows astronomers to calculate a star’s
precise mass, age and chemical composition.
11. "A planet passing in front of a star can be detected by the fall in light
from that star. Small oscillations of the star also produce changes in the light
emitted, which reveal what the star is made of and how they are structured
internally. This data will provide a major boost to our understanding of how
stars form and evolve," Prof Roxburgh said.
12. Since the discovery in 1995 of the first "exoplanet" - a planet orbiting
a star other than the Sun - more than 200 others have been found by ground-based
observatories.
13. Until now the usual method of finding exoplanets has been to detect the
"wobble" their gravity imparts on parent stars. But only giant gaseous planets
bigger than Jupiter can be found this way, and they are unlikely to harbour
life.
14. In the 2010s, ESA plans to launch Darwin, a fleet of four or five
interlinked space telescopes that will not only spot small rocky planets, but
analyse their atmospheres for signs of biological activity.
15. At around the same time, the US space agency, Nasa, will launch
Terrestrial Planet Finder, another space telescope designed to locate Earth-like
planets.
Choose the appropriate letter from A-D for question 1.
1. Corot is an instrument which
(A) can help to search for certain planets
(B) is used to find planets in the orbit
(C) can locate planets with human beings
(D) can spot any planets with water.
Do the following statements agree with the information given in the reading
passage? For questions 2-5 write
TRUE if the statement agrees with the information
FALSE if the statement contraicts the information
NOT GIVEN if there is no information on this in the passage
2. Scientists are trying to find out about the planets that can be
inhabited.
3. BBC Radio 4 recently focuses on the broadcasting of Corot.
4. Passing objects might cause a fall in light.
5. Corot can tell whether there is another Earth-like planet.
Based on your reading of the passage, complete the sentences below with words
taken from the passage. Use NO MORE THAN THREE WORDS for each answer.
With measurements, scientists will be able to search for some gaseous and
rocky planets. They will be extremely excited if they can discover some small 6.
__________, the expected number of which could be up to 7. __________ .
Corot will enable scientists to study the 8. __________ of stars. In this
way, a star’s mass, age and chemical composition can be calculated.
According to Prof Roxburgh, changes in light can be caused by passing planets
or star 9. __________. The related statistics can gain us a better 10.
__________ of the star formation and evolvement.
Observatories have found many exoplanets, which are 11. __________ other
stars than the Sun. The common way used in finding exoplanets can only detect
huge gas planets, which do not 12. ___________ .
With the launching of Darwin, astronomers will be able to analyse whether
those rocky planets have 13. __________ for life.
-
Don't wash those fossils!
Standard museum practice can wash away DNA.
1.Washing, brushing and varnishing fossils — all standard conservation
treatments used by many fossil hunters and museum curators alike — vastly
reduces the chances of recovering ancient DNA.
2.Instead, excavators should be handling at least some of their bounty with
gloves, and freezing samples as they are found, dirt and all, concludes a paper
in the Proceedings of the National Academy of Sciences today.
3.Although many palaeontologists know anecdotally that this is the best way
to up the odds of extracting good DNA, Eva-Maria Geigl of the Jacques Monod
Institute in Paris, France, and her colleagues have now shown just how important
conservation practices can be.This information, they say, needs to be hammered
home among the people who are actually out in the field digging up bones.
4.Geigl and her colleagues looked at 3,200-year-old fossil bones belonging to
a single individual of an extinct cattle species, called an aurochs.The fossils
were dug up at a site in France at two different times — either in 1947, and
stored in a museum collection, or in 2004, and conserved in sterile conditions
at -20 oC.
5.The team's attempts to extract DNA from the 1947 bones all failed.The newly
excavated fossils, however, all yielded DNA.
6.Because the bones had been buried for the same amount of time, and in the
same conditions, the conservation method had to be to blame says Geigl."As much
DNA was degraded in these 57 years as in the 3,200 years before," she says.
Wash in, wash out
7.Because many palaeontologists base their work on the shape of fossils
alone, their methods of conservation are not designed to preserve DNA, Geigl
explains.
8.The biggest problem is how they are cleaned.Fossils are often washed
together on-site in a large bath, which can allow water — and contaminants in
the form of contemporary DNA — to permeate into the porous bones."Not only is
the authentic DNA getting washed out, but contamination is getting washed in,"
says Geigl.
9.Most ancient DNA specialists know this already, says Hendrik Poinar, an
evolutionary geneticist at McMaster University in Ontario, Canada.But that
doesn't mean that best practice has become widespread among those who actually
find the fossils.
10.Getting hold of fossils that have been preserved with their DNA in mind
relies on close relationships between lab-based geneticists and the excavators,
says palaeogeneticist Svante P bo of the Max Planck Institute for Evolutionary
Anthropology in Leipzig, Germany.And that only occurs in exceptional cases, he
says.
11.P bo's team, which has been sequencing Neanderthal DNA, continually faces
these problems."When you want to study ancient human and Neanderthal remains,
there's a big issue of contamination with contemporary human DNA," he says.
12.This doesn't mean that all museum specimens are fatally flawed, notes P
bo.The Neanderthal fossils that were recently sequenced in his own lab, for
example, had been part of a museum collection treated in the traditional way.But
P bo is keen to see samples of fossils from every major find preserved in line
with Geigl's recommendations — just in case.
Warm and wet
13.Geigl herself believes that, with cooperation between bench and field
researchers, preserving fossils properly could open up avenues of discovery that
have long been assumed closed.
14.Much human cultural development took place in temperate regions.DNA does
not survive well in warm environments in the first place, and can vanish when
fossils are washed and treated.For this reason, Geigl says, most ancient DNA
studies have been done on permafrost samples, such as the woolly mammoth, or on
remains sheltered from the elements in cold caves — including cave bear and
Neanderthal fossils.
15.Better conservation methods, and a focus on fresh fossils, could boost DNA
extraction from more delicate specimens, says Geigl.And that could shed more
light on the story of human evolution.
(640 words nature )
Glossary
Palaeontologists 古生物学家
Aurochs 欧洲野牛
Neanderthal (人类学)尼安德特人，旧石器时代的古人类。
Permafrost (地理)永冻层
Questions 1-6
Answer the following questions by using NO MORE THAN THREE WORDS for each
answer.
1.How did people traditionally treat fossils?
2.What suggestions do Geigl and her colleagues give on what should be done
when fossils are found?
3.What problems may be posed if fossil bones are washed on-site? Name
ONE.
4.What characteristic do fossil bones have to make them susceptible to be
contaminated with contemporary DNA when they are washed?
5.What could be better understood when conservation treatments are
improved?
6.The passage mentioned several animal species studied by researchers.How
many of them are mentioned?
Questions 7-11
Do the following statements agree with the information given in the passage?
Please write TRUE if the statement agrees with the writer FALSE if the statement
does not agree with the writer NOT GIVEN if there is no information about this
in the passage.
7.In their paper published in the Proceedings of the National Academy of
Sciences，Geigl and her colleagues have shown what conservation practices should
be followed to preserve ancient DNA.
8.The fossil bones that Geigl and her colleagues studied are all from the
same aurochs.
9.Geneticists don't have to work on site.
10.Only newly excavated fossil bones using new conservation methods suggested
by Geigl and her colleagues contain ancient DNA.
11.Paabo is still worried about the potential problems caused by treatments
of fossils in traditional way.
Questions 12-13
Complete the following the statements by choosing letter A-D for each
answer.
12.“This information” in paragraph 3 indicates:
[A] It is critical to follow proper practices in preserving ancient DNA.
[B] The best way of getting good DNA is to handle fossils with gloves.
[C] Fossil hunters should wear home-made hammers while digging up bones.
[D] Many palaeontologists know how one should do in treating fossils.
13.The study conducted by Geigl and her colleagues suggests:
[A] the fact that ancient DNA can not be recovered from fossil bones
excavated in the past.
[B] the correlation between the amount of burying time and that of the
recovered DNA.
[C] the pace at which DNA degrades.
[D] the correlation between conservation practices and degradation of
DNA.
-
-
Rogue theory of smell gets a boost
1.A controversial theory of how we smell, which claims that our fine sense of
odour depends on quantum mechanics, has been given the thumbs up by a team of
physicists.
2.Calculations by researchers at University College London (UCL) show that
the idea that we smell odour molecules by sensing their molecular vibrations
makes sense in terms of the physics involved.
3.That's still some way from proving that the theory, proposed in the
mid-1990s by biophysicist Luca Turin, is correct.But it should make other
scientists take the idea more seriously.
4."This is a big step forward," says Turin, who has now set up his own
perfume company Flexitral in Virginia.He says that since he published his
theory, "it has been ignored rather than criticized."
5.Most scientists have assumed that our sense of smell depends on receptors
in the nose detecting the shape of incoming molecules, which triggers a signal
to the brain.This molecular 'lock and key' process is thought to lie behind a
wide range of the body's detection systems: it is how some parts of the immune
system recognise invaders, for example, and how the tongue recognizes some
tastes.
6.But Turin argued that smell doesn't seem to fit this picture very
well.Molecules that look almost identical can smell very different — such as
alcohols, which smell like spirits, and thiols, which smell like rotten eggs.And
molecules with very different structures can smell similar.Most strikingly, some
molecules can smell different — to animals, if not necessarily to humans —
simply because they contain different isotopes (atoms that are chemically
identical but have a different mass).
7.Turin's explanation for these smelly facts invokes the idea that the smell
signal in olfactory receptor proteins is triggered not by an odour molecule's
shape, but by its vibrations, which can enourage an electron to jump between two
parts of the receptor in a quantum-mechanical process called tunnelling.This
electron movement could initiate the smell signal being sent to the brain.
8.This would explain why isotopes can smell different: their vibration
frequencies are changed if the atoms are heavier.Turin's mechanism, says
Marshall Stoneham of the UCL team, is more like swipe-card identification than a
key fitting a lock.
9.Vibration-assisted electron tunnelling can undoubtedly occur — it is used
in an experimental technique for measuring molecular vibrations."The question is
whether this is possible in the nose," says Stoneham's colleague, Andrew
Horsfield.
10.Stoneham says that when he first heard about Turin's idea, while Turin was
himself based at UCL, "I didn't believe it".But, he adds, "because it was an
interesting idea, I thought I should prove it couldn't work.I did some simple
calculations, and only then began to feel Luca could be right." Now Stoneham and
his co-workers have done the job more thoroughly, in a paper soon to be
published in Physical Review Letters.
11.The UCL team calculated the rates of electron hopping in a nose receptor
that has an odorant molecule bound to it.This rate depends on various properties
of the biomolecular system that are not known, but the researchers could
estimate these parameters based on typical values for molecules of this
sort.
12.The key issue is whether the hopping rate with the odorant in place is
significantly greater than that without it.The calculations show that it is —
which means that odour identification in this way seems theoretically
possible.
13.But Horsfield stresses that that's different from a proof of Turin's
idea."So far things look plausible, but we need proper experimental
verification.We're beginning to think about what experiments could be
performed."
14.Meanwhile, Turin is pressing ahead with his hypothesis."At Flexitral we
have been designing odorants exclusively on the basis of their computed
vibrations," he says."Our success rate at odorant discovery is two orders of
magnitude better than the competition." At the very least, he is putting his
money where his nose is.
Questions 5-9
Complete the sentences below with words from the passage.Use NO MORE THAN
THREE WORDS for each answer.
5.The hypothesis that we smell by sensing the molecular vibration was made by
______.
6.Turin's company is based in ______.
7.Most scientists believed that our nose works in the same way as our
______.
8.Different isotopes can smell different when ______ weigh differently.
9.According to Audrew Horsfield, it is still to be proved that ______ could
really occur in human nose.
-
-
In the earliest stages of man's development he had nomore need of money than animals have.He was content with very simple forms of shelter,made his own rough tools and weapons and could provide food and clothing for himself and his family from natural materials around him.As he became more civilized,however,he began to want better shelter,more efficient tools and weapons,and more comfortable and more lasting clothing than could be provided by his own neighborhood or by the work of his own unskilled hands.For these things he had to turn to the skilled people such as smiths,leather workers or carpenters.It was then that the question of payment arose.
At first he got what he wanted by a simple process ofexchange.The smith who had not the time to look after land or cattle was glad to take meat or grain from the farmer inexchange for an axe or a plough.But as more and more goods which had no fixed exchange value came on the market,exchange became too complicated to be satisfactory.Another problem arose when those who made things wanted to get stocks of wood or leather,or iron,but had nothing to offer in exchange until their finished goods were ready. Thus the difficulties of exchange led by degrees to the invention of money.In some countries easily handled things like seeds or shells were given a certain value and the farmer,instead of paying the smith for a new axe by giving him some meat or grain,gave him so many shells.If the smith had any shells left when he had bought his food,he could get stocks of the raw materials of his trade.In some countries quite large things such as cows or camels or even big flat stones were used for trade.Later,pieces of metal,bearing values according to the rarity of the metal and the size of the pieces,or coins were used.Money as we know it had arrived.
1.Exchange of goods became difficult because _________.
A man became more civilized
B smiths began to look after land or cattle in their spare time
C more and more goods which had no fixed exchange alues came to the
marker
D farmers hadn't enough grain or meat to provide for
skilled workers
2.Money was not used until _______.
A paper was invented
B people practiced a simple process of exchange
C nothing could be offered in exchangeD the exchange of one thing for another became too complicated
3.The best title for this passage is _____.
A What is money
B What are money's functions.
C The importance of money
D The beginning of money
-
To begin with,"muzak"(音乐广播网 )was intended simplyto createasoothing(安慰)atmosphere.Recently,however,it's ecome big business —thanks in part to recentresearch.Dr.Ronald Milliman,an American marketing expert,hasshown that music can boost sales or increase factory roduction by as much as a third.But,it has to be light music.A fast one has no effect atall on sales.Slow music can increase receipts by 38%.This isprobably because shoppers slow down and have more opportunityto spot items they like to buy.Yet,slow music isn't alway sanswer.Dr.Milliman found,for example,that in restaurants slowmusic meant customers took longer to eat their meals,whichreduced overall sales.So restaurants owners might be welladvised to play up-tempo music to keep the customers moving—unless of course,the resulting indigestion leads tocomplaints!
练习：
1.The reason why background music is so popular isthat ______.
A.it can have a powerful effect on those who hear it
B.it can help to create a soothing atmosphere
C.it can boost sales or increase factory production erywhere
D.it can make customers eat their meals quickly
2.Background music means ________.
A.light music that customers enjoy mostB.fast music that makes people move
fast
C.slow music that can make customers enjoy their meals
D.the music you are listening to while you are doingomething
3.Restaurant owners complain about background musicbecause ______.
A.it results in indigestion
B.it increases their sales
C.it keeps customers moving
D.it decreases their sales
4.The word"up-tempo music"probably means_____.
A.slow music
B.fast music
C.light music
D.classical music
-
Intheearlieststagesofman'sdevelopmenthehadnomoreneedofmoneythananimalshave.Hewascontentwithverysimpleformsofshelter,madehisownroughtoolsandweaponsandcouldprovidefoodandclothingforhimselfandhisfamilyfromnaturalmaterialsaroundhim.Ashebecamemorecivilized,however,hebegantowantbettershelter,moreefficienttoolsandweapons,andmorecomfortableandmorelastingclothingthancouldbeprovidedbyhisownneighborhoodorbytheworkofhisownunskilledhands.Forthesethingshehadtoturntotheskilledpeoplesuchassmiths,leatherworkersorcarpenters.Itwasthenthatthequestionofpaymentarose.
Atfirsthegotwhathewantedbyasimpleprocessofexchange.Thesmithwhohadnotthetimetolookafterlandorcattlewasgladtotakemeatorgrainfromthefarmerinexchangeforanaxeoraplough.Butasmoreandmoregoodswhichhadnofixedexchangevaluecameonthemarket,exchangebecametoocomplicatedtobesatisfactory.Anotherproblemarosewhenthosewhomadethingswantedtogetstocksofwoodorleather,oriron,buthadnothingtoofferinexchangeuntiltheirfinishedgoodswereready.Thusthedifficultiesofexchangeledbydegreestotheinventionofmoney.Insomecountrieseasilyhandledthingslikeseedsorshellsweregivenacertainvalueandthefarmer,insteadofpayingthesmithforanewaxebygivinghimsomemeatorgrain,gavehimsomanyshells.Ifthesmithhadanyshellsleftwhenhehadboughthisfood,hecouldgetstocksoftherawmaterialsofhistrade.Insomecountriesquitelargethingssuchascowsorcamelsorevenbigflatstoneswereusedfortrade.Later,piecesofmetal,bearingvaluesaccordingtotherarityofthemetalandthesizeofthepieces,orcoinswereused.Moneyasweknowithadarrived.
1.Exchangeofgoodsbecamedifficultbecause_________.
Amanbecamemorecivilized
Bsmithsbegantolookafterlandorcattleintheirsparetime
Cmoreandmoregoodswhichhadnofixedexchangealuescametothemarker
Dfarmershadn'tenoughgrainormeattoprovidefor
skilledworkers
2.Moneywasnotuseduntil_______.
Apaperwasinvented
Bpeoplepracticedasimpleprocessofexchange
CnothingcouldbeofferedinexchangeDtheexchangeofonethingforanotherbecametoocomplicated
3.Thebesttitleforthispassageis_____.
AWhatismoney
BWhataremoney'sfunctions.
CTheimportanceofmoney
DThebeginningofmoney
-
Tobeginwith,"muzak"(音乐广播网)wasintendedsimplytocreateasoothing(安慰)atmosphere.Recently,however,it'secomebigbusiness—thanksinparttorecentresearch.Dr.RonaldMilliman,anAmericanmarketingexpert,hasshownthatmusiccanboostsalesorincreasefactoryroductionbyasmuchasathird.But,ithastobelightmusic.Afastonehasnoeffectatallonsales.Slowmusiccanincreasereceiptsby38%.Thisisprobablybecauseshoppersslowdownandhavemoreopportunitytospotitemstheyliketobuy.Yet,slowmusicisn'talwaysanswer.Dr.Millimanfound,forexample,thatinrestaurantsslowmusicmeantcustomerstooklongertoeattheirmeals,whichreducedoverallsales.Sorestaurantsownersmightbewelladvisedtoplayup-tempomusictokeepthecustomersmoving—unlessofcourse,theresultingindigestionleadstocomplaints!
练习：
1.Thereasonwhybackgroundmusicissopopularisthat______.
A.itcanhaveapowerfuleffectonthosewhohearit
B.itcanhelptocreateasoothingatmosphere
C.itcanboostsalesorincreasefactoryproductionerywhere
D.itcanmakecustomerseattheirmealsquickly
2.Backgroundmusicmeans________.
A.lightmusicthatcustomersenjoymostB.fastmusicthatmakespeoplemovefast
C.slowmusicthatcanmakecustomersenjoytheirmeals
D.themusicyouarelisteningtowhileyouaredoingomething
3.Restaurantownerscomplainaboutbackgroundmusicbecause______.
A.itresultsinindigestion
B.itincreasestheirsales
C.itkeepscustomersmoving
D.itdecreasestheirsales
4.Theword"up-tempomusic"probablymeans_____.
A.slowmusic
B.fastmusic
C.lightmusic
D.classicalmusic
-
SellingDigitalMusicwithoutCopy-protectionMakesSense
A. Itwasuncharacteristicallylow-keyfortheindustry’sgreatestshowman.ButtheessaypublishedthisweekbySteveJobs,thebossofApple,onhisfirm’swebsiteundertheunassumingtitle“ThoughtsonMusic”hasnonethelessprovokedavigorousdebateaboutthefutureofdigitalmusic,whichAppledominateswithitsiPodmusic-playerandiTunesmusic-store.Atissueis“digitalrightsmanagement”(DRM)—thetechnologyguardingdownloadedmusicagainsttheft.SincethereisnocommonstandardforDRM,italsohastheside-effectthatsongspurchasedforonetypeofmusic-playermaynotworkonanother.Apple’sDRMsystem,calledFairPlay,isthemostwidespread.SoitcameasasurprisewhenMr.JobscalledforDRMfordigitalmusictobeabolished.
B. ThisisachangeoftackforApple.IthascomeunderfirefromEuropeanregulatorswhoclaimthatitsrefusaltolicenseFairPlaytootherfirmshas“lockedin”customers.SincemusicfromtheiTunesstorecannotbeplayedonnon-iPodmusic-players(atleastnotwithoutalotoffiddling),anyiTunesbuyerwillbedeterredfromswitchingtoadevicemadebyarivalfirm,suchasSonyorMicrosoft.WhenFrenchlawmakersdraftedabilllastyearcompellingAppletoopenupFairPlaytorivals,thecompanywarnedof“state-sponsoredpiracy”.OnlyDRM,itimplied,couldkeepthepiratesatbay.
C. ThisweekMr.JobsgaveanotherexplanationforhisformerdefenceofDRM:therecordcompaniesmadehimdoit.TheywouldmaketheirmusicavailabletotheiTunesstoreonlyifAppleagreedtoprotectitusingDRM.TheycanstillwithdrawtheircataloguesiftheDRMsystemiscompromised.ApplecannotlicenseFairPlaytoothers,saysMrJobs,becauseitwoulddependonthemtoproducesecurityfixespromptly.AllDRMdoesisrestrictconsumerchoiceandprovideabarriertoentry,saysMrJobs;withoutittherewouldbefarmorestoresandplayers,andfarmoreinnovation.So,hesuggests,whynotdoawaywithDRMandsellmusicunprotected?“Thisisclearlythebestalternativeforconsumers,”hedeclares,“andApplewouldembraceitinaheartbeat.”
D. Whythesuddenchangeofheart?MrJobsseemschieflyconcernedwithgettingEurope’sregulatorsoffhisback.RatherthancomplainingtoAppleaboutitsuseofDRM,hesuggests,“thoseunhappywiththecurrentsituationshouldredirecttheirenergiestowardspersuadingthemusiccompaniestoselltheirmusicDRM-free.”Twoandahalfofthefourbigrecordcompanies,hehelpfullypointsout,areEuropean-owned.MrJobsalsohopestopainthimselfasaconsumerchampion.AppleresentsaccusationsthatithasbecometheMicrosoftofdigitalmusic.
E. Applecanaffordtoembraceopencompetitioninmusicplayersandonlinestores.Consumerswouldgravitatetothebestplayerandthebeststore,andatthemomentthatstillmeansApple’s.MrJobsisevidentlyunfazedbyrivalstotheiPod.Sinceonly3%ofthemusicinatypicaliTuneslibraryisprotected,mostofitcanalreadybeusedonotherplayerstoday,henotes.(AndeventheprotectedtrackscanbeburnedontoaCDandthenre-ripped.)SoApple’sdominanceevidentlydependsfarmoreonbrandingandeaseofusethanDRM-related“lockin”.
F. ThemusicgiantsaretryingDRM-freedownloads.Lotsofsmallerlabelsalreadysellmusicthatway.Havingseenwhichwaythewindisblowing,MrJobsnowwantstobeseennotasDRM’sdefender,butasaconsumerchampionwhohelpedinitsdownfall.Wouldn’titleadtoasurgeinpiracy?No,becausemostmusicisstillsoldunprotectedonCDs,peoplewishingtostealmusicalreadycandoso.Indeed,scrappingDRMwouldprobablyincreaseonline-musicsalesbyreducingconfusionandincompatibility.Withtheleadingonlinestore,Applewouldbenefitmost.MrJobs’sargument,inshort,istransparentlyself-serving.Italsohappenstoberight.
NotestoReadingPassage1
1.low-key:
抑制的，受约束的，屈服的
2.showman:
开展览会的人,出风头的人物
3.unassuming:
谦逊的,不夸耀的,不装腔作势的
4.iPod：
(苹果公司出产的)音乐播放器
5.iTunesstore：
(苹果公司出产的)在线音乐商店
6.getoffperson’sback:
不再找某人的麻烦，摆脱某人的纠缠
7.gravitate:
受吸引，倾向于
8.unfazed:
不再担忧，不被打扰
Questions1-7
DothefollowingstatemetsreflecttheclaimsofthewriterinReadingPassage1?
WriteyouranswerinBoxes1-7onyouranswersheet.
TRUEifthestatementrefletstheclaimsofthewriter
FALSEifthestatementcontradictstheclaimsofthewriter
NOTGIVENifitisimpossbiletosaywhatthewriterthinksaboutthis
1.AppleenjoysacontrollingpositionindigitalmusicmarketwithitsiPodmusic-playerandiTunesmusic-store.
2.DRMisagovernmentdecreeissuedwithapurposetoprotectdownloadedmusicfromtheftbyconsumers.
3.LackofstandardizationinDRMmakessongsboughtforonekindofmusicplayermaynotfunctiononanother.
4.ApplehasbeencriticizedbyEuropeanregulatorssinceithasrefusedtograntalicenseFairPlaytootherfirms.
5.Allmusiccanbeeasilyplayedonnon-iPodmusicdevicesfromSonyorMicrosoftwithouttoomuchfiddling.
6.AppledependsfarmoreonDRMratherthanbrandingforitsdominanceofthedigitalmusicdevices.
7.IfDRMwascancelled,Sonywouldcertainlydominatetheinternationaldigitalmusicmarket.
Questions8-10
ChoosetheappropriatelettersA-Dandwritetheminboxes8-10onyouranswesheet.
8.WhichofthefollowingstatementsaboutMr.Jobs’ideaofDRMisNOTTRUE?
A.DRMplacesrestrictionsonconsumer’choiceofdigitalmusicproductsavailable.
B.DRMcomplesiTunesbuyerstoswitchtoadevicemadebySonyorMicrosoft.
C.DRMconstitutesabarrierforpotentialconsumerstoenterdigitalmusicmarkets.
D.DRMhindersdevelopmentofmorestoresandplayersandtechnicalinnovation.
9.Theword“unfazed”inline3ofparagraphE,means___________.
A.refused
B.welcomed
C.notbothered
D.notwellreceived
10.WhichofthefollowingstatementsisTRUEifDRMwasscapped?
A.Sonywouldgainthemostprofit.
B.Morecustomerswouldbe“lockedin”.
C.Asuddenincreaseinpiracywouldoccur.
D.Online-musicsaleswouldprobablydecrease.
Questions11-14
Completethenotesbelow.
ChooseNOMORETHANTHREEWORDSfromReadingPassage1foreachanswer.
Writeyouranswersinboxes11-14onyouranswersheet.
Mr.SteveJobs,thebossofApple,explainsthereasonwhyheusedtodefendDRM,sayingthatthecompanywasforcedtodoso:therecordcompanieswouldmaketheirmusicaccessibleto…11...onlyiftheyagreedtoprotectitusingDRM;theycanstill…12…iftheDRMsystemiscompromised.HealsoprovidesthereasonwhyAppledidnotlicenseFairPlaytoothers:thecompanyreliesonthemto…13….ButnowhechangeshismindwithapossibleexpectationthatEurope’sregulatorswouldnottroublehimanymoreinthefuture.Heproposesthatthosewhoareunsatisfactorywiththecurrentsituationindigitalmusicmarketshould…14…towardspersuadethemusiccompaniestoselltheirmusicDRM-free.
-
newweapontofightcancer
1.Britishscientistsarepreparingtolaunchtrialsofaradicalnewwaytofightcancer,whichkillstumoursbyinfectingthemwithviruseslikethecommoncold.
2.Ifsuccessful,virustherapycouldeventuallyformathirdpillaralongsideradiotherapyandchemotherapyinthestandardarsenalagainstcancer,whileavoidingsomeofthedebilitatingside-effects.
3.LeonardSeymour,aprofessorofgenetherapyatOxfordUniversity,whohasbeenworkingonthevirustherapywithcolleaguesinLondonandtheUS,willleadthetrialslaterthisyear.CancerResearchUKsaidyesterdaythatitwasexcitedbythepotentialofProfSeymour’spioneeringtechniques.
4.Oneofthecountry’sleadinggeneticists,ProfSeymourhasbeenworkingwithvirusesthatkillcancercellsdirectly,whileavoidingharmtohealthytissue."Inprinciple,you’vegotsomethingwhichcouldbemanytimesmoreeffectivethanregularchemotherapy,"hesaid.
5.Cancer-killingvirusesexploitthefactthatcancercellssuppressthebody’slocalimmunesystem."Ifacancerdoesn’tdothat,theimmunesystemwipesitout.Ifyoucangetavirusintoatumour,virusesfindthemaverygoodplacetobebecausethere’snoimmunesystemtostopthemreplicating.Youcanregarditasthecancer’sAchilles’heel."
6.Onlyasmallamountofthevirusneedstogettothecancer."Theyreplicate,yougetamillioncopiesineachcellandthecellburstsandtheyinfectthetumourcellsadjacentandrepeattheprocess,"saidProfSeymour.
7.Preliminaryresearchonmiceshowsthatthevirusesworkwellontumoursresistanttostandardcancerdrugs."It’saninterestingpossibilitythattheymayhaveanadvantageinkillingdrug-resistanttumours,whichcouldbequitedifferenttoanythingwe’vehadbefore."
8.Researchershaveknownforsometimethatvirusescankilltumourcellsandsomeaspectsoftheworkhavealreadybeenpublishedinscientificjournals.Americanscientistshavepreviouslyinjectedvirusesdirectlyintotumoursbutthistechniquewillnotworkifthecancerisinaccessibleorhasspreadthroughoutthebody.
9.ProfSeymour’sinnovativesolutionistomaskthevirusfromthebody’simmunesystem,effectivelyallowingthevirusestodowhatchemotherapydrugsdo-spreadthroughthebloodandreachtumourswherevertheyare.Thebighurdlehasalwaysbeentofindawaytodelivervirusestotumoursviathebloodstreamwithoutthebody’simmunesystemdestroyingthemontheway.
10."Whatwe’vedoneismakechemicalmodificationstothevirustoputapolymercoataroundit-it’sastealthviruswhenyouinjectit,"hesaid.
11.Afterthestealthvirusinfectsthetumour,itreplicates,butthecopiesdonothavethechemicalmodifications.Iftheyescapefromthetumour,thecopieswillbequicklyrecognisedandmoppedupbythebody’simmunesystem.
12.Thetherapywouldbeespeciallyusefulforsecondarycancers,calledmetastases,whichsometimesspreadaroundthebodyafterthefirsttumourappears."There’sanawfulstatisticofpatientsinthewest...withmalignantcancers;75%ofthemgoontodiefrommetastases,"saidProfSeymour.
13.Twovirusesarelikelytobeexaminedinthefirstclinicaltrials:adenovirus,whichnormallycausesacold-likeillness,andvaccinia,whichcausescowpoxandisalsousedinthevaccineagainstsmallpox.Forsafetyreasons,bothwillbedisabledtomakethemlesspathogenicinthetrial,butProfSeymoursaidheeventuallyhopestousenaturalviruses.
14.Thefirsttrialswilluseuncoatedadenovirusandvacciniaandwillbedeliveredlocallytolivertumours,inordertoestablishwhetherthetreatmentissafeinhumansandwhatdoseofviruswillbeneeded.Severalmoreyearsoftrialswillbeneeded,eventuallyalsoonthepolymer-coatedviruses,beforethetherapycanbeconsideredforuseintheNHS.Thoughtheapproachwillbeexaminedatfirstforcancersthatdonotrespondtoconventionaltreatments,ProfSeymourhopesthatonedayitmightbeappliedtoallcancers.
Questions1-6
Dothefollowingstatementsagreewiththeinformationgiveninthereadingpassage?Forquestions1-6write
TRUEifthestatementagreeswiththeinformation
FALSEifthestatementcontradictstheinformation
NOTGIVENifthereisnoinformationonthisinthepassage
1.Virustherapy,ifsuccessful,hasanadvantageineliminatingside-effects.
2.CancerResearchUKisquitehopefulaboutProfessorSeymour’sworkonthevirustherapy.
3.Viruscankillcancercellsandstopthemfromgrowingagain.
4.Cancer’sAchilles’heelreferstothefactthatvirusmaystaysafelyinatumorandreplicate.
5.Toinfectthecancercells,agooddealofvirusesshouldbeinjectedintothetumor.
6.Researchesonanimalsindicatethatviruscouldbeusedasanewwaytotreatdrug-resistanttumors.
Question7-9
Basedonthereadingpassage,choosetheappropriateletterfromA-Dforeachanswer.
7.Informationaboutresearchesonviruseskillingtumorcellscanbefound
(A)onTV
(B)inmagazines
(C)oninternet
(D)innewspapers
8.Totreattumorsspreadingoutinbody,researcherstryto
(A)changethebody’immunesystem
(B)injectchemotherapydrugsintobloodstream.
(C)increasetheamountofinjection
(D)disguisethevirusesonthewaytotumors.
9.Whenthechemicalmodifiedvirusintumorreplicates,thecopies
(A)willsoonescapefromthetumorandspreadout.
(B)willbewipedoutbythebody’simmunesystem.
(C)willbeimmediatelyrecognizedbytheresearchers.
(D)willeventuallystopthetumorfromspreadingout.
Questions10-13
Completethesentencesbelow.Chooseyouranswersfromthelistofwords.Youcanonlyuseeachwordonce.
NBTherearemorewordsinthelistthanspacessoyouwillnotusethemall.
Inthefirstclinicaltrials,scientistswilltryto……10……adenovirusandvaccinia,soboththeviruseswillbelesspathogenicthanthe……11…….Theseuncoatedviruseswillbeapplieddirectlytocertainareastoconfirmsafetyonhumanbeingsandtheright……12……needed.Theexperimentswillfirstlybe……13……tothetreatmentofcertaincancers
-
HowaFrenchmanisrevivingMcDonald’sinEurope
A.WhenDenisHennequintookoverastheEuropeanbossofMcDonald’sinJanuary2004,theworld’sbiggestrestaurantchainwasshowingsignsofrecoveryinAmericaandAustralia,butsalesinEuropeweresluggishordeclining.OneexceptionwasFrance,whereMrHennequinhaddoneasterlingjobasheadofthegroup’sFrenchsubsidiarytosellmoreBigMacstohiscompatriots.Histaskwastoreplicatethissuccessinall41oftheEuropeancountrieswhereanti-globalisers’favouriteenemyoperates.
B.SofarMrHennequinisdoingwell.LastyearEuropeansalesincreasedby5.8%andthenumberofcustomersby3.4%,thebestannualresultsinnearly15years.Europeaccountedfor36%ofthegroup’sprofitsandfor28%ofitssales.DecemberwasanespeciallygoodmonthascustomerstooktoseasonalmenuofferingsinFranceandBritain,andtoapromotioninGermanybasedonthegameofMonopoly.
C.MrHennequin’srecipeforrevivalistobemoreopenabouthiscompany’soperations,tobe“locallyrelevant”,andtoimprovetheexperienceofvisitinghis6,400restaurants.McDonald’sisblamedformakingpeoplefat,exploitingworkers,treatinganimalscruelly,pollutingtheenvironmentandsimplyforbeingAmerican.MrHennequinsayshewantstoengageinadialoguewiththepublictoaddresstheseconcerns.
D.Heintroduced“opendoor”visitordaysineachcountrywhichbecamehugelypopular.InPolandalonesome50,000visitorscametoMcDonald’sthroughthevisitors’programmelastyear.TheNutritionInformationInitiative,launchedlastyear,putdetailedlabelsonMcDonald’spackagingwithdataoncalories,protein,fat,carbohydratesandsaltcontent.Thedetailsarealsoprintedontray-liners.
E.MrHennequinalsowantspeopletoknowthat“McJobs”,thelow-paidmenialjobsatMcDonald’srestaurants,aremuchbetterthanpeoplethink.Butsomeofhiseffortshavebackfired:lastyearhesparkedacontroversywiththeintroductionofa“McPassport”thatallowsMcDonald’semployeestoworkanywhereintheEuropeanUnion.PoliticiansaccusedthefirmofaploytomakecheaplabourfromeasternEuropemoreeasilyavailabletoMcDonald’smanagersacrossthecontinent.
F.Tostayintouchwithlocalneedsandpreferences,McDonald’semployslocalbossesasmuchaspossible.ARussianisrunningMcDonald’sinRussia,thoughaSerbisinchargeofGermany.Thegroupbuysmainlyfromlocalsuppliers.Four-fifthsofitssuppliesinFrancecomefromlocalfarmers,forexample.(SomeoftheFrenchfarmerswhocampaignedagainstthecompanyinthelate1990ssubsequentlydiscoveredthatitwas,infact,buyingtheirproduce.)AndithirescelebritiessuchasHeidiKlum,aGermanmodel,aslocalbrandambassadors.
G.InhispreviousjobMrHennequinestablisheda“designstudio”inFrancetospruceuphiscompany’sdrabrestaurantsandadapttheinteriortolocaltastes.ThestudioisnowmastermindingimprovementseverywhereinEurope.Healsosetupa“foodstudio”,wherecooksdevisenewrecipesinresponsetolocaltrends.
H.GivenFrance’sreputationasthemostanti-AmericancountryinEurope,itseemsoddthatMcDonald’srevivalinEuropeisbeingledbyaFrenchman,usingideascookedupintheFrenchmarket.ButFranceisinfactthecompany’smostprofitablemarketafterAmerica.ThemarketwhereMcDonald’sisweakestinEuropeisnotFrance,butBritain.
I.“FixingBritainshouldbehispriority,”saysDavidPalmer,arestaurantanalystatUBS.Almosttwo-thirdsofthe1,214McDonald’srestaurantsinBritainarecompany-owned,comparedwith40%inEuropeand15%inAmerica.Thecompanysuffersfromthevolatilityofsalesatitsownrestaurants,butcanrelyonsteadyincomefromfranchisees.Soitshouldsellasmanyunderperformingoutletsaspossible,saysMrPalmer.
J.M.MarkWiltamuth,ananalystatMorganStanley,estimatesthatEuropeancompany-ownedrestaurants’marginswillincreaseslightlyto16.4%in2007.Thisisstilllessthaninthelate1990sandbelowAmerica’s18-19%today.ButitismuchbetterthanbeforeMrHennequin’sreign.HeisalreadybeingtippedasthefirstEuropeancandidateforthegroup’stopjobinIllinois.NobodywouldcallthataMcJob.
NotestoReadingPassage1
1.sterling高质量的
e.g.Hehasmanysterlingqualities.他身上有许多优秀的品质。
2.menial不体面的,乏味的(工作、职业)
3.spruceup打扮整齐、漂亮、装饰
4.mastermind指挥、谋划(一个计划或活动)
e.g.Thepoliceknowwhomastermindedtherobbery.警察知道是谁策划了那次抢劫。
5.underperform表现不佳表现出低于标准的工作水平、企业出现亏本
Questions1-6
DothefollowingstatementsreflecttheclaimsofthewriterinReadingPassage1?
WriteyouranswerinBoxes1-6onyouranswersheet.
TRUEifthestatementreflectstheclaimsofthewriter
FALSEifthestatementcontradictstheclaimsofthewriter
NOTGIVENifitisimpossibletosaywhatthewriterthinksaboutthis
1.McDonaldwasshowingthesignofrecoveryinallEuropeancountriesexceptFranceafterDenisHennequintookofficeasthebossofEuro-markets.
2.Startingfromlastyear,detailedlabelsareputonMcDonald’spackaginganddetailedinformationisalsoprintedontray-liners.
3.Franceissaidtobethemostanti-AmericancountryinEurope,buttheideasofthe“opendoor”visitingdaysand“McPassport”areinventedintheFrenchmarket.
4.BritainpossessestheweakestMcDonaldmarketamongEuropeancountriesandapproximately1214McDonald’srestaurantsarecompany-owned.
5.AccordingtoDavidPalmer,arestaurantanalystatUBS,DavidHennequinshouldtreattheproblemaboutMcDonaldinBritainasthemostimportantthing.
6.DavidPalmersuggestedthatthemanagementofMcDonalodinItalyshouldsellasmanyitsoutletswhichlosemoneyinbusinessaspossibleforrevival.
Questions7-10
ChoosetheappropriatelettersA-Dandwritetheminboxes7-10onyouranswesheet.
7.Theword“sterling”inline3ofParagraphAmeans__________.
A.difficult
B.menial
C.terrible
D.excellent
8.WhichofthefollowingstatementsontheaccusationofMacDonaldisNOTTRUE?
A.Ittendstomakepeoplefat.
B.Itsoperationsareveryvague.
C.Ittendstoexploitworkers.
D.Ittendstotreatanimalscruelly.
9.WhichofthefollowingmeasurestakenbyDenisHennequinproducedundesiredresult?
A.“FoodStudio”scheme.
B.“OpenDoor”visitordays.
C.The“McPassport”scheme.
D.TheNutritionInformationInitiative.
10.WhatdidDenisHennequindosoastorespondtolocaltrends?
A.setupa“FoodStudio”.
B.establisheda“DesignStudio”.
C.hiredcelebritiesaslocalbrandambassadors.
D.employedlocalbossesasmuchaspossible.
Questions11-14
Completeeachofthefollowingstatements(Questions11-14)withwordsornumbertakenfromReadingPassage1.
WriteNOMORETHANTHREEWORDSforeachanswer.
Writeyouranswersinboxes11-14onyouranswersheet.
11.AfterJanuary2004,McDonaldwasmakingimprovementfollowingaperiodofslumpinAmericaandAustralia,butsalesinEuropewere………………………….
12.BusinessofMcDonaldinFranceandBritainwasparticularlygoodinDecembersincecustomerstookto……………………………..
13.Comparedwithothercountries,FranceisMcDonald’s……………………….nexttoAmerica.
14.…………………….ofMcDonald’srestaurantsinAmericaarecompanied–ownedandthefigureismuchlowerthanthatinBritain.
-
1There'sadimmerswitchinsidethesunthatcausesitsbrightnesstoriseandfallontimescalesofaround100,000years-exactlythesameperiodasbetweeniceagesonEarth.Sosaysaphysicistwhohascreatedacomputermodelofourstar'score.
2RobertEhrlichofGeorgeMasonUniversityinFairfax,Virginia,modelledtheeffectoftemperaturefluctuationsinthesun'sinterior.Accordingtothestandardview,thetemperatureofthesun'scoreisheldconstantbytheopposingpressuresofgravityandnuclearfusion.However,Ehrlichbelievedthatslightvariationsshouldbepossible.
3HetookashisstartingpointtheworkofAttilaGrandpierreoftheKonkolyObservatoryoftheHungarianAcademyofSciences.In2005,Grandpierreandacollaborator,Gáborágoston,calculatedthatmagneticfieldsinthesun'scorecouldproducesmallinstabilitiesinthesolarplasma.Theseinstabilitieswouldinducelocalisedoscillationsintemperature.
4Ehrlich'smodelshowsthatwhilstmostoftheseoscillationscanceleachotherout,somereinforceoneanotherandbecomelong-livedtemperaturevariations.Thefavouredfrequenciesallowthesun'scoretemperaturetooscillatearounditsaveragetemperatureof13.6millionkelvinincycleslastingeither100,000or41,000years.Ehrlichsaysthatrandominteractionswithinthesun'smagneticfieldcouldflipthefluctuationsfromonecyclelengthtotheother.
5ThesetwotimescalesareinstantlyrecognisabletoanyonefamiliarwithEarth'siceages:forthepastmillionyears,iceageshaveoccurredroughlyevery100,000years.Beforethat,theyoccurredroughlyevery41,000years.
6MostscientistsbelievethattheiceagesaretheresultofsubtlechangesinEarth'sorbit,knownastheMilankovitchcycles.OnesuchcycledescribesthewayEarth'sorbitgraduallychangesshapefromacircletoaslightellipseandbackagainroughlyevery100,000years.ThetheorysaysthisalterstheamountofsolarradiationthatEarthreceives,triggeringtheiceages.However,apersistentproblemwiththistheoryhasbeenitsinabilitytoexplainwhytheiceageschangedfrequencyamillionyearsago.
7"InMilankovitch,thereiscertainlynogoodideawhythefrequencyshouldchangefromonetoanother,"saysNeilEdwards,aclimatologistattheOpenUniversityinMiltonKeynes,UK.NoristhetransitionproblemtheonlyonetheMilankovitchtheoryfaces.EhrlichandothercriticsclaimthatthetemperaturevariationscausedbyMilankovitchcyclesaresimplynotbigenoughtodriveiceages.
8However,EdwardsbelievesthesmallchangesinsolarheatingproducedbyMilankovitchcyclesarethenamplifiedbyfeedbackmechanismsonEarth.Forexample,ifseaicebeginstoformbecauseofaslightcooling,carbondioxidethatwouldotherwisehavefounditswayintotheatmosphereaspartofthecarboncycleislockedintotheice.ThatweakensthegreenhouseeffectandEarthgrowsevencolder.
9AccordingtoEdwards,thereisnolackofsuchmechanisms."Ifyouaddtheireffectstogether,thereismorethanenoughfeedbacktomakeMilankovitchwork,"hesays."Theproblemnowisidentifyingwhichmechanismsareatwork."ThisiswhyscientistslikeEdwardsarenotyetreadytogiveuponthecurrenttheory."Milankovitchcyclesgiveusiceagesroughlywhenweobservethemtohappen.Wecancalculatewhereweareinthecycleandcompareitwithobservation,"hesays."Ican'tseeanywayoftesting[Ehrlich's]ideatoseewhereweareinthetemperatureoscillation."
10Ehrlichconcedesthis."Ifthereisawaytotestthistheoryonthesun,Ican'tthinkofonethatispractical,"hesays.That'sbecausevariationover41,000to100,000yearsistoogradualtobeobserved.However,theremaybeawaytotestitinotherstars:reddwarfs.Theircoresaremuchsmallerthanthatofthesun,andsoEhrlichbelievesthattheoscillationperiodscouldbeshortenoughtobeobserved.Hehasyettocalculatethepreciseperiodortheextentofvariationinbrightnesstobeexpected.
11NigelWeiss,asolarphysicistattheUniversityofCambridge,isfarfromconvinced.HedescribesEhrlich'sclaimsas"utterlyimplausible".EhrlichcountersthatWeiss'sopinionisbasedonthestandardsolarmodel,whichfailstotakeintoaccountthemagneticinstabilitiesthatcausethetemperaturefluctuations.
Questions1-4
CompleteeachofthefollowingstatementswithOneorTwonamesofthescientistsfromtheboxbelow.
WritetheappropriatelettersA-Einboxes1-4onyouranswersheet.
A.AttilaGrandpierre
B.Gáborágoston
C.NeilEdwards
D.NigelWeiss
E.RobertEhrlich
1....claimsthereadimmerswitchinsidethesunthatcausesitsbrightnesstoriseandfallinperiodsaslongasthosebetweeniceagesonEarth.
2....calculatedthattheinternalsolarmagneticfieldscouldproduceinstabilitiesinthesolarplasma.
3....holdsthatMilankovitchcyclescaninducechangesinsolarheatingonEarthandthechangesareamplifiedonEarth.
4....doesn'tbelieveinEhrlich'sviewpointsatall.
Questions5-9
Dothefollowingstatementsagreewiththeinformationgiveninthereadingpassage?
Inboxes5-9onyouranswersheetwrite
TRUEifthestatementistrueaccordingtothepassage
FALSEifthestatementisfalseaccordingtothepassage
NOTGIVENiftheinformationisnotgiveninthepassage
5.Theiceageschangedfrequencyfrom100,000to41,000yearsamillionyearsago.
6.ThesoleproblemthattheMilankovitchtheorycannotsolveistoexplainwhytheiceagefrequencyshouldshiftfromonetoanother.
7.Carbondioxidecanbelockedartificiallyintoseaicetoeliminatethegreenhouseeffect.
8.SomescientistsarenotreadytogiveuptheMilankovitchtheorythoughtheyhaven'tfiguredoutwhichmechanismsamplifythechangesinsolarheating.
9.BothEdwardsandEhrlichbelievethatthereisnopracticalwaytotestwhenthesolartemperatureoscillationbeginsandwhenends.
Questions10-14
Completethenotesbelow.
ChooseonesuitablewordfromtheReadingPassageaboveforeachanswer.
Writeyouranswersinboxes10-14onyouranswersheet.
Thestandardviewassumesthattheopposingpressuresofgravityandnuclearfusionsholdthetemperature...10...inthesun'sinterior,buttheslightchangesintheearth's...11...alterthetemperatureontheearthandcauseiceagesevery100,000years.ABritishscientist,however,challengesthisviewbyclaimingthattheinternalsolarmagnetic...12...caninducethetemperatureoscillationsinthesun'sinterior.Thesun'scoretemperatureoscillatesarounditsaveragetemperaturein...13...lastingeither100,000or41,000years.Andthe...14...interactionswithinthesun'smagneticfieldcouldflipthefluctuationsfromonecyclelengthtotheother,whichexplainswhytheiceageschangedfrequencyamillionyearsago.
-
FelicityLawrence
ThursdayDecember28,2006
TheGuardian
1.ConsumersaretobepresentedwithtworivalnewyearadvertisingcampaignsastheFoodStandardsAgencygoespublicinitsbattlewiththeindustryoverthelabellingofunhealthyfoods.
2.TheGuardianhaslearnedthattheFSAwilllaunchaseriesof10-secondtelevisionadvertsinJanuarytellingshoppershowtofollowared,amberandgreentrafficlightlabellingsystemonthefrontoffoodpacks,whichisdesignedtotackleBritain’sobesityepidemic.
3.Thecampaignisadirectresponsetoaconcertedattemptbyleadingfoodmanufacturersandretailers,includingKellogg’sandTesco,toderailthesystem.Theindustryfearsthattrafficlightswoulddemoniseentirecategoriesoffoodsandcouldseriouslydamagethemarketforthosethatarefatty,saltyorhighinsugar.
4.TheUKmarketforbreakfastcerealsisworth￡1.27bnayearandthemanufacturersfearitwillbeseverelydentedifredlightlabelsareputonpackagingdrawingattentiontothefactthatthemajorityarehighinsaltand/orsugar.
5.Theindustryisplanningamajormarketingcampaignforacompetinglabellingsystemwhichavoidscolour-codinginfavourofinformationaboutthepercentageof"guidelinedailyamounts"(GDAs)offat,saltandsugarcontainedintheirproducts.
6.Thebattleforthenation’sdietcomesasnewrulesontelevisionadvertisingcomeintoforceinJanuarywhichwillbaradvertsforunhealthyfoodsfromcommercialbreaksduringprogrammesaimedatchildren.SourcesattheTVregulatorsarebracedforalegalchallengefromtheindustryandhavedescribedthelobbyingeffortstoblockanynewadbanorcolour-codedlabellingas"themostferociouswe’veeverexperienced".
7.Ofcom’schiefexecutive,EdRichards,said:"Wearepreparedtofaceuptoanylegalactionfromtheindustry,butweverymuchhopeitwillnotbenecessary."TheFSAsaiditwasexpectinganonslaughtfromtheindustryinJanuary.SeniorFSAofficialssaidthemanufacturers’effortstoundermineitsproposalsonlabellingcouldthreatentheagency’scredibility.
8.TerrenceCollis,FSAdirectorofcommunications,dismissedclaimsthattheproposalswerenotbasedonscience."WehavesomeofthemostrespectedscientistsinEurope,bothwithintheFSAandinourindependentadvisorycommittees.ItisunjustifiedandnonsensicaltoattacktheFSA’sscientificreputationandtotrytoundermineitscredibility."
9.TheFSAisunderstoodtohavebriefeditsadagency,United,beforeChristmas,andwillaimtoairadsthatare"non-confrontational,humorousandfactual"asacounterweighttoindustry’seffortsaboutthesametime.Theagency,however,willhaveatinyfractionofthebudgetavailabletotheindustry.
10.GavinNeath,chairmanofUnileverUKandpresidentoftheFoodandDrinkFederation,hassaidthattheindustryhasmadeenormousprogressbutcouldnotacceptred"stop"signsonitsfood.
11.AlastairSykes,chiefexecutiveofNestléUK,saidthatundertheFSAproposalsallhiscompany’sconfectioneryandmostofitscerealswouldscoreared."Arewesayingpeopleshouldn’teatconfectionery?We’redrivenbyconsumersandwhattheywant,andmuchofwhatwedohasbeentomakeourproductshealthier,"hesaid.
12.ChrisWermann,directorofcommunicationsatKellogg’s,said:"Inprinciplewecouldneveraccepttrafficlightlabelling."
13.TherivallabellingschemeintroducedbyKellogg’s,Danone,Unilever,Nestlé,KraftandTescoandnowfavouredby21manufacturers,usesanindustry-devisedsystembasedonidentifyingGDAsofkeynutrients.TescosaysithastestedbothtrafficlightsandGDAlabelsinitsstoresandthatthelatterincreasedsalesofhealthierfoods.
14.ButtheFSAsaiditcouldnotlivewiththisGDAsystemalonebecauseitwas"notscientific"oreasyforshopperstounderstandataglance.
Questions1-6
AnswerthequestionsbelowusingNOMORETHANTHREEWORDSfromthepassageforeachanswer.
1.Whenwillinstructionsbegivenonreadingthecolor-codedlabels?
2.Wherecancustomersfindtheredlightlabels?
3.WhatproblemistheFSAtryingtohandlewiththelabelingsystem?
4.Whichproductsellswellbutmaynotbehealthy?
5.Whatinformation,accordingtothemanufacturers,canbelabeledonproducts?
6.Whatcannotbeadvertisedduringchildren’sprogrammes?
Questions7-13
Usetheinformationinthetexttomatchthepeople(listedA-E)withtheopinions(listed7-13)below.Writetheappropriateletter(A-E)forquestions1-7.
NBYoumayuseanylettermorethanonce.
AEdRichard
BTerrenceCollis
CGavinNeath
DAlastairSykes
EChrisWermann
7.Generallywewillnotagreetousetheredlightlabels.
8.ItisunreasonabletodoubtifFSAistrustworthy.
9.Wearetryingtomeetourconsumers’needs.
10.Thefoodindustryhasbeenimprovinggreatly.
11.Thecolor-codedlabelingsystemisscientific.
12.OurproductswillbelabeledunhealthybytheFSA.
13.Wearereadytoconfrontthemanufacturers.
-
1.AEuropeanspacecrafttookofftodaytospearheadthesearchforanother"Earth"amongthestars.
2.TheCorotspacetelescopeblastedoffaboardaRussianSoyuzrocketfromtheBaikonurcosmodromeinKazakhstanshortlyafter2.20pm.
3.Corot,shortforconvectionrotationandplanetarytransits,isthefirstinstrumentcapableoffindingsmallrockyplanetsbeyondthesolarsystem.Anysuchplanetsituatedintherightorbitstandsagoodchanceofhavingliquidwateronitssurface,andquitepossiblylife,althoughaleadingscientistinvolvedintheprojectsaiditwasunlikelytofind"anylittlegreenmen".
4.DevelopedbytheFrenchspaceagency,CNES,andpartneredbytheEuropeanSpaceAgency(ESA),Austria,Belgium,Germany,BrazilandSpain,Corotwillmonitoraround120,000starswithits27cmtelescopefromapolarorbit514milesabovetheEarth.Overtwoandahalfyears,itwillfocusonfivetosixdifferentareasofthesky,measuringthebrightnessofabout10,000starsevery512seconds.
5."Atthepresentmomentwearehopingtofindoutmoreaboutthenatureofplanetsaroundstarswhicharepotentialhabitats.Wearelookingathabitableplanets,notinhabitedplanets.Wearenotgoingtofindanylittlegreenmen,"ProfessorIanRoxburgh,anESAscientistwhohasbeeninvolvedwithCorotsinceitsinception,toldtheBBCRadio4Todayprogramme.
6.ProfRoxburghsaiditwashopedCorotwouldfind"rockyplanetsthatcoulddevelopanatmosphereand,iftheyaretherightdistancefromtheirparentstar,theycouldhavewater".
7.Tosearchforplanets,thetelescopewilllookforthedimmingofstarlightcausedwhenanobjectpassesinfrontofastar,knownasa"transit".Althoughitwilltakemoresophisticatedspacetelescopesplannedinthenext10yearstoconfirmthepresenceofanEarth-likeplanetwithoxygenandliquidwater,Corotwillletscientistsknowwheretopointtheirlenses.
8.MeasurementsofminutechangesinbrightnesswillenablescientiststodetectgiantJupiter-likegasplanetsaswellassmallrockyones.Itistherockyplanets-thatcouldbenobiggerthanabouttwicethesizeoftheEarth-whichwillcausethemostexcitement.Scientistsexpecttofindbetween10and40ofthesesmallerplanets.
9.Corotwillalsoprobeintostellarinteriorsbystudyingtheacousticwavesthatrippleacrossthesurfaceofstars,atechniquecalled"asteroseismology".
10.Thenatureoftheripplesallowsastronomerstocalculateastar’sprecisemass,ageandchemicalcomposition.
11."Aplanetpassinginfrontofastarcanbedetectedbythefallinlightfromthatstar.Smalloscillationsofthestaralsoproducechangesinthelightemitted,whichrevealwhatthestarismadeofandhowtheyarestructuredinternally.Thisdatawillprovideamajorboosttoourunderstandingofhowstarsformandevolve,"ProfRoxburghsaid.
12.Sincethediscoveryin1995ofthefirst"exoplanet"-aplanetorbitingastarotherthantheSun-morethan200othershavebeenfoundbyground-basedobservatories.
13.Untilnowtheusualmethodoffindingexoplanetshasbeentodetectthe"wobble"theirgravityimpartsonparentstars.ButonlygiantgaseousplanetsbiggerthanJupitercanbefoundthisway,andtheyareunlikelytoharbourlife.
14.Inthe2010s,ESAplanstolaunchDarwin,afleetoffourorfiveinterlinkedspacetelescopesthatwillnotonlyspotsmallrockyplanets,butanalysetheiratmospheresforsignsofbiologicalactivity.
15.Ataroundthesametime,theUSspaceagency,Nasa,willlaunchTerrestrialPlanetFinder,anotherspacetelescopedesignedtolocateEarth-likeplanets.
ChoosetheappropriateletterfromA-Dforquestion1.
1.Corotisaninstrumentwhich
(A)canhelptosearchforcertainplanets
(B)isusedtofindplanetsintheorbit
(C)canlocateplanetswithhumanbeings
(D)canspotanyplanetswithwater.
Dothefollowingstatementsagreewiththeinformationgiveninthereadingpassage?Forquestions2-5write
TRUEifthestatementagreeswiththeinformation
FALSEifthestatementcontraictstheinformation
NOTGIVENifthereisnoinformationonthisinthepassage
2.Scientistsaretryingtofindoutabouttheplanetsthatcanbeinhabited.
3.BBCRadio4recentlyfocusesonthebroadcastingofCorot.
4.Passingobjectsmightcauseafallinlight.
5.CorotcantellwhetherthereisanotherEarth-likeplanet.
Basedonyourreadingofthepassage,completethesentencesbelowwithwordstakenfromthepassage.UseNOMORETHANTHREEWORDSforeachanswer.
Withmeasurements,scientistswillbeabletosearchforsomegaseousandrockyplanets.Theywillbeextremelyexcitediftheycandiscoversomesmall6.__________,theexpectednumberofwhichcouldbeupto7.__________.
Corotwillenablescientiststostudythe8.__________ofstars.Inthisway,astar’smass,ageandchemicalcompositioncanbecalculated.
AccordingtoProfRoxburgh,changesinlightcanbecausedbypassingplanetsorstar9.__________.Therelatedstatisticscangainusabetter10.__________ofthestarformationandevolvement.
Observatorieshavefoundmanyexoplanets,whichare11.__________otherstarsthantheSun.Thecommonwayusedinfindingexoplanetscanonlydetecthugegasplanets,whichdonot12.___________.
WiththelaunchingofDarwin,astronomerswillbeabletoanalysewhetherthoserockyplanetshave13.__________forlife.
邮箱：